| Clone Name | rbastl13c02 |
|---|---|
| Clone Library Name | barley_pub |
>FRZG_MYXXA (P31758) Protein-glutamate methylesterase frzG (EC 3.1.1.61)| Length = 334 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 339 PAAHASELGDRIAQSLEAWSSTSVVRRIVGAEHEVL 232 P A+ + D + L W S R++ AEH+VL Sbjct: 177 PIAYCQHISDGFTEGLAHWLSNETALRVLEAEHDVL 212
>MT2_CANGA (P15114) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| [Contains: Metallothionein-2' (MT-2') (Metallothionein-II') (MT-II')] Length = 51 Score = 29.6 bits (65), Expect = 1.9 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 115 SCCGVPLYICCNSITEWCCTRAVRCLTC 32 +CC P C NS + C + +C TC Sbjct: 22 NCCAKPACACTNSASNECSCQTCKCQTC 49
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 118 YSCCGVPLYICCNSITEWCCTRAVRCLTCFY 26 + CC +P +CC S + CC + CL Y Sbjct: 384 WGCCPIPEAVCC-SDNQHCCPQGFTCLAQGY 413
>FIXC_RHISN (Q53208) Protein fixC| Length = 435 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +3 Query: 135 QNFINSSATPKIEKPILT*AALV*SR 212 QNF+ TPKIEK T AAL+ +R Sbjct: 393 QNFVRVDGTPKIEKERATTAALIKAR 418
>AMY1_SACFI (P21567) Alpha-amylase precursor (EC 3.2.1.1)| Length = 494 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +2 Query: 194 SFSLESTIFLNSASTSCSAPTILLTTLVELH 286 S S E T ++S ++SCS PT LLT VE H Sbjct: 294 SSSSELTQMISSVASSCSDPT-LLTNFVENH 323
>FIXC_RHIME (P09820) Protein fixC| Length = 435 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +3 Query: 135 QNFINSSATPKIEKPILT*AALV*SR 212 QNF+ TPKIE+ I T AA + +R Sbjct: 393 QNFVRVDGTPKIEREIATTAAFLRAR 418
>TOR2_YEAST (P32600) Phosphatidylinositol 3-kinase TOR2 (EC 2.7.1.137)| (PtdIns-3-kinase TOR2) (PI3-kinase TOR2) (PI3K TOR2) Length = 2473 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/45 (24%), Positives = 26/45 (57%) Frame = +1 Query: 28 KSKSNNEQL*CNTILLYCYNICIMEHHNKNRTKFMCKISSTLVQH 162 K+ +N+ + IL+ C+ + + HH + T+F+ I+ + ++H Sbjct: 560 KTGESNDDITDAQILIQCFKMLQLIHHQYSLTEFVRLITISYIEH 604 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,592,053 Number of Sequences: 219361 Number of extensions: 660787 Number of successful extensions: 1661 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1660 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)