| Clone Name | rbastl12g06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEG2_RAT (Q9Z144) Galectin-2 | 28 | 4.5 | 2 | PHR_BUCBP (Q89AJ9) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.... | 28 | 7.8 | 3 | CREA_COCCA (Q9HFS2) DNA-binding protein creA (Carbon catabolite ... | 28 | 7.8 | 4 | SPEB1_SYNY3 (P72703) Agmatinase 1 (EC 3.5.3.11) (Agmatine ureohy... | 28 | 7.8 |
|---|
>LEG2_RAT (Q9Z144) Galectin-2| Length = 130 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 3 ERSNVLNITAEVSIRGQYKGTVHNHLCSFKSNLKPQKQTL 122 E+ V N+ + + + KG +HN + SF NL K+TL Sbjct: 3 EKFEVTNLNMKSGMSLKIKGKIHNDVNSFTINLGQGKETL 42
>PHR_BUCBP (Q89AJ9) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.3) (DNA| photolyase) (Photoreactivating enzyme) Length = 478 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 7/54 (12%) Frame = +1 Query: 61 ELSTI-TYAVSKAISNHKNK------P*PLVKYVKHNSRKLYFIIKHVCLSNKV 201 ELS + TY + N+K P P++ Y H+ +K + KH SNK+ Sbjct: 426 ELSNVSTYNIHNPCDNNKTNKIHSKYPQPIINYY-HSKKKTLLVFKHAKCSNKL 478
>CREA_COCCA (Q9HFS2) DNA-binding protein creA (Carbon catabolite repressor)| Length = 430 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 285 NHLTPGLVSALTTYHSGHLTRSCLPSSTHLVRQTDMFDD 169 ++ +PG+ + L YH G L+ S PS L R D+ D Sbjct: 187 SNYSPGMSNDLAAYHQGGLSNSSSPSG--LARPMDLLAD 223
>SPEB1_SYNY3 (P72703) Agmatinase 1 (EC 3.5.3.11) (Agmatine ureohydrolase 1) (AUH| 1) Length = 306 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 3 ERSNVLNITAEVSIRGQYKGTVHNHLCSFKSNLKPQKQTL--ATSQICK 143 E V+ I A +R +++G+ HNH C + L+ TL A IC+ Sbjct: 137 EPFTVVQIDAHGDMRDKFEGSCHNHACVMRRVLELGLPTLPIAIRAICQ 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,072,802 Number of Sequences: 219361 Number of extensions: 605644 Number of successful extensions: 1620 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1620 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)