| Clone Name | rbastl12e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YNE2_YEAST (P53958) Hypothetical 43.7 kDa protein in YIP3-TFC5 i... | 34 | 0.12 | 2 | YALV_TRYBB (P17958) Hypothetical 25.6 kDa protein in aldolase lo... | 28 | 6.6 |
|---|
>YNE2_YEAST (P53958) Hypothetical 43.7 kDa protein in YIP3-TFC5 intergenic| region Length = 396 Score = 33.9 bits (76), Expect = 0.12 Identities = 21/58 (36%), Positives = 30/58 (51%) Frame = +3 Query: 12 RLQASSNFTEQRIHFWIRNSSLVVSSSPHVTDGNQPTR*SDNDEGLKSSSDLPDVAGA 185 +L +SS +IH V +SSP GNQP +N EG +SS +LP + G+ Sbjct: 77 KLASSSGLPINQIHKLFNTDHGVPASSPMKAGGNQP---HNNTEGTQSSENLPRLNGS 131
>YALV_TRYBB (P17958) Hypothetical 25.6 kDa protein in aldolase locus (ORFV)| Length = 232 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 15 LQASSNFTEQRIHFWIRNSSLVVSSSPHVTDG 110 L S+ FTE+++H WI S V S P T G Sbjct: 152 LVGSNLFTEEQLHRWIGRSLKDVESKPPATIG 183 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,497,040 Number of Sequences: 219361 Number of extensions: 386518 Number of successful extensions: 803 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)