| Clone Name | rbastl12b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LAMA4_HUMAN (Q16363) Laminin alpha-4 chain precursor | 29 | 3.7 | 2 | LRIG1_MOUSE (P70193) Leucine-rich repeats and immunoglobulin-lik... | 28 | 6.3 |
|---|
>LAMA4_HUMAN (Q16363) Laminin alpha-4 chain precursor| Length = 1823 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +3 Query: 105 DSSKWLPLG-KLPKLSVTAAGKHCHLKHSPQQVA---ALSGTAGQR 230 D+ W P+ KLP+ + T HCHL +SP+ + GTA R Sbjct: 1435 DAPSWDPVALKLPERN-TPRNSHCHLSNSPRAIEHAYQYGGTANSR 1479
>LRIG1_MOUSE (P70193) Leucine-rich repeats and immunoglobulin-like domains protein| 1 precursor (LIG-1) Length = 1091 Score = 28.1 bits (61), Expect = 6.3 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = +2 Query: 53 IHFSNC---KLSLSISKELVGQFKMVAPWKATKIVSHRCRQTLSPETFATTGSCLVRDSR 223 IH + C KL + ++E PWK T+ + +T +P T A +GS + D Sbjct: 889 IHSTTCRQPKLCVGYTRE---------PWKVTE----KADRTAAPHTTAHSGSAVCSDCS 935 Query: 224 TETS 235 T+T+ Sbjct: 936 TDTA 939 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,615,902 Number of Sequences: 219361 Number of extensions: 613458 Number of successful extensions: 1459 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1459 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)