| Clone Name | rbastl12a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DEF2_COXBU (Q83AK6) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) ... | 33 | 0.26 | 2 | SYGA_RICPR (Q9ZCB0) Glycyl-tRNA synthetase alpha chain (EC 6.1.1... | 30 | 2.2 | 3 | SYGA_RICCN (Q92G10) Glycyl-tRNA synthetase alpha chain (EC 6.1.1... | 28 | 6.4 | 4 | CHK1_YEAST (P38147) Serine/threonine-protein kinase CHK1 (EC 2.7... | 28 | 8.4 |
|---|
>DEF2_COXBU (Q83AK6) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) (Polypeptide| deformylase 2) Length = 209 Score = 32.7 bits (73), Expect = 0.26 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -1 Query: 146 IEGCSSIYARFGIGSKEIHLLLSVWVYM*PISAREN*MLQYHKK 15 IEGC S+ + G+ + +H+ L+ W+Y A +YH++ Sbjct: 98 IEGCLSVPGKVGVVERYVHVELTAWLYHSDTEALSKIKREYHRE 141
>SYGA_RICPR (Q9ZCB0) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 289 Score = 29.6 bits (65), Expect = 2.2 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +3 Query: 15 FFMILQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 146 F +Q S PG +R +HPNR Q KPS D LY Sbjct: 52 FIAYVQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQDLY 95
>SYGA_RICCN (Q92G10) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 288 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 27 LQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 146 +Q S PG +R +HPNR Q KPS D LY Sbjct: 56 VQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQELY 95
>CHK1_YEAST (P38147) Serine/threonine-protein kinase CHK1 (EC 2.7.11.1)| (Checkpoint kinase 1) Length = 527 Score = 27.7 bits (60), Expect = 8.4 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Frame = +1 Query: 25 YCNIQFSLAEIGYI-YTQ--TDNNRWISLLPIPNRA*IDEHPSINTSTKTGADLPAAFVD 195 + +++ SL+ Y+ +TQ NNR+IS PI N EH S++ T + D Sbjct: 305 FSHLKVSLSNENYLKFTQDTNSNNRYISTQPIGNELAELEHDSMHFQTVSNTQRAFTSYD 364 Query: 196 SKYPY 210 S Y Sbjct: 365 SNTNY 369 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,164,224 Number of Sequences: 219361 Number of extensions: 657888 Number of successful extensions: 1432 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1432 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)