| Clone Name | rbastl11h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ARY2_MOUSE (P50295) Arylamine N-acetyltransferase 2 (EC 2.3.1.5)... | 30 | 2.0 | 2 | ARY2_MESAU (P50293) Arylamine N-acetyltransferase 2 (EC 2.3.1.5)... | 29 | 3.5 | 3 | E434_ADECT (P87568) Early E4 30 kDa protein | 28 | 4.5 | 4 | ARY1_HUMAN (P18440) Arylamine N-acetyltransferase 1 (EC 2.3.1.5)... | 28 | 4.5 | 5 | IGA3_HAEIN (P45385) Immunoglobulin A1 protease precursor (EC 3.4... | 28 | 5.9 | 6 | OPSL_LIMPO (P35360) Lateral eye opsin | 28 | 7.7 |
|---|
>ARY2_MOUSE (P50295) Arylamine N-acetyltransferase 2 (EC 2.3.1.5) (Arylamide| acetylase 2) (N-acetyltransferase type 2) (NAT-2) Length = 290 Score = 29.6 bits (65), Expect = 2.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 227 AQQFCSEHGPFGVHCIVGTT 286 ++ FCS P GVHC+VG+T Sbjct: 219 SKSFCSLQTPEGVHCLVGST 238
>ARY2_MESAU (P50293) Arylamine N-acetyltransferase 2 (EC 2.3.1.5) (Arylamide| acetylase 2) (Arylamine N-acetyltransferase, polymorphic) (PNAT) (N-acetyltransferase type 2) (NAT-2) (AT-2) Length = 290 Score = 28.9 bits (63), Expect = 3.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 227 AQQFCSEHGPFGVHCIVGTT 286 ++ FCS P GVHC+VG T Sbjct: 219 SKSFCSLQTPEGVHCLVGCT 238
>E434_ADECT (P87568) Early E4 30 kDa protein| Length = 259 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 291 WLVVPTMQCTPNGPCSLQNCWAW 223 WLV+ C+ CSL+NC W Sbjct: 177 WLVLKCKSCSLQNYCSLKNCAVW 199
>ARY1_HUMAN (P18440) Arylamine N-acetyltransferase 1 (EC 2.3.1.5) (Arylamide| acetylase 1) (Arylamine N-acetyltransferase, monomorphic) (MNAT) (N-acetyltransferase type 1) (NAT-1) Length = 290 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 227 AQQFCSEHGPFGVHCIVGTT 286 ++ FCS P GVHC+VG T Sbjct: 219 SKSFCSLQTPDGVHCLVGFT 238
>IGA3_HAEIN (P45385) Immunoglobulin A1 protease precursor (EC 3.4.21.72) (IGA1| protease) Length = 1545 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = -1 Query: 240 QNCWAWDINVSFAASLYMGRKLETYTRNLSTN 145 +N A +INV+ A+LY GR +E+ T N++ + Sbjct: 743 RNFKATNINVTNNATLYSGRNVESITSNITAS 774
>OPSL_LIMPO (P35360) Lateral eye opsin| Length = 376 Score = 27.7 bits (60), Expect = 7.7 Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 8/65 (12%) Frame = -2 Query: 227 HGISMLVLQLVCIWGGNWKHIPVI*AQ--------TRVTTDAMSKDYLYLNFDA*YYVLY 72 H + L+L V IW G W +P T T D ++KD+ A Y V+Y Sbjct: 160 HKKATLLLLFVWIWSGGWTILPFFGWSRYVPEGNLTSCTVDYLTKDW----SSASYVVIY 215 Query: 71 SLKSY 57 L Y Sbjct: 216 GLAVY 220 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,303,597 Number of Sequences: 219361 Number of extensions: 752545 Number of successful extensions: 1451 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1451 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)