| Clone Name | rbastl11f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1 | 29 | 3.4 | 2 | VGLP_BEV (P23052) Peplomer glycoprotein precursor | 28 | 5.8 | 3 | ATG26_ASHGO (Q751Z4) Sterol 3-beta-glucosyltransferase (EC 2.4.1... | 28 | 7.6 | 4 | VGLM_EBV (P03215) Glycoprotein M | 27 | 9.9 |
|---|
>RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1| Length = 1269 Score = 28.9 bits (63), Expect = 3.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 199 SSGI*RCLYLLDVIIQCYMHLTPSFYELVNYV 104 +S I C Y L+ + YM+ TP +E+VN++ Sbjct: 1086 ASNIKACQYTLETLCHMYMNDTPMKFEIVNHM 1117
>VGLP_BEV (P23052) Peplomer glycoprotein precursor| Length = 1581 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -1 Query: 179 FVPS*CHNSVLYAPDAIFL*VGELCFFTFGTIIIGWQY 66 FV C+N+ LY PDA+F T + + W Y Sbjct: 342 FVAQECYNNALYLPDAVFT--------TLFSTLFSWDY 371
>ATG26_ASHGO (Q751Z4) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1227 Score = 27.7 bits (60), Expect = 7.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -2 Query: 181 CLYLLDVIIQCYMHLTPSFYELVNYVFLLLGQSLLVGNTPIC 56 C L DV+IQ +++LT +++ G + L GN IC Sbjct: 208 CWLLRDVLIQGHIYLTSRNLLFFAFLYKSNGSARLTGNLSIC 249
>VGLM_EBV (P03215) Glycoprotein M| Length = 405 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/69 (23%), Positives = 33/69 (47%) Frame = -1 Query: 257 SVLREFWCWCTVYYLKPLCLQWHLEMFVPS*CHNSVLYAPDAIFL*VGELCFFTFGTIII 78 S+ ++ + W V+YLKP+ +L L ++FL +G +F G +++ Sbjct: 187 SIPQDTFLWWVVFYLKPVVTNLYLGCLA-----LETLVFSLSVFLALGNSFYFMVGDMVL 241 Query: 77 GWQYSYLLV 51 G +L++ Sbjct: 242 GAVNLFLIL 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,443,232 Number of Sequences: 219361 Number of extensions: 839915 Number of successful extensions: 1877 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1877 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)