| Clone Name | rbastl11e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RT04_ACACA (P46755) Mitochondrial ribosomal protein S4 | 32 | 0.32 | 2 | SECA_ODOSI (P49649) Preprotein translocase secA subunit | 29 | 2.7 | 3 | KPC4_DROME (P83099) Putative protein kinase C, delta type homolo... | 29 | 3.5 | 4 | REPL_BPP1 (P19654) Replication protein repL | 28 | 7.9 |
|---|
>RT04_ACACA (P46755) Mitochondrial ribosomal protein S4| Length = 374 Score = 32.3 bits (72), Expect = 0.32 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -3 Query: 211 FLRGRFCTASCSNIWTPPPLVIFPFV*YCC*KFMHRFLFFY 89 F++ +C +SCSNI+T L+ FP + ++R L FY Sbjct: 133 FIKHNYCLSSCSNIYTQTKLLYFPII------SVNRGLVFY 167
>SECA_ODOSI (P49649) Preprotein translocase secA subunit| Length = 888 Score = 29.3 bits (64), Expect = 2.7 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -1 Query: 267 GWHDIGHFT--SKHSADMYCVFSVEGFVQRHVVIY 169 GW G S++ D Y +F G V RH+VIY Sbjct: 846 GWRKYGQRNPLSEYKEDAYKLFKYRGIVTRHLVIY 880
>KPC4_DROME (P83099) Putative protein kinase C, delta type homolog (EC| 2.7.11.13) Length = 643 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 7/63 (11%) Frame = -1 Query: 192 VQRHVVIYGRPHPWLFSLLCSTAAKSSCTVFFSFTLGRHLL-------PFSLNNARFFYA 34 ++R V+ G HP+L L C+ +S + G L+ FS ARF+ A Sbjct: 362 IERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGA 421 Query: 33 TVV 25 ++ Sbjct: 422 EII 424
>REPL_BPP1 (P19654) Replication protein repL| Length = 281 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 104 TVHELLAAVLHKRENNQGWGRP 169 TV+E L AVL K ++N+ WG P Sbjct: 255 TVNEALNAVLAKNKDNEQWGIP 276 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,324,155 Number of Sequences: 219361 Number of extensions: 944869 Number of successful extensions: 2016 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1987 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2016 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)