| Clone Name | rbastl09h10 |
|---|---|
| Clone Library Name | barley_pub |
>HLDE_CAMJE (Q6TG09) Bifunctional protein hldE [Includes: D-beta-D-heptose| 7-phosphate kinase (EC 2.7.1.-) (D-beta-D-heptose 7-phosphotransferase); D-beta-D-heptose 1-phosphate adenosyltransferase (EC 2.7.7.-)] Length = 461 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 173 EIIYACHVRNSGSGLPLSKVGWVSVAF 93 EI AC + N + + +SK+G VSV+F Sbjct: 274 EIFKACELANEAAAVVVSKIGSVSVSF 300
>PSG3_HUMAN (Q16557) Pregnancy-specific beta-1-glycoprotein 3 precursor| (PSBG-3) (Carcinoembryonic antigen SG5) Length = 428 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 167 IYACHVRNSGSGLPLSKVGWVSVAFWSG 84 +YAC VRNS +G+ SK V V+ SG Sbjct: 391 LYACSVRNSATGMESSKSMTVKVSAPSG 418
>PSG7_HUMAN (Q13046) Pregnancy-specific beta-1-glycoprotein 7 precursor| (PSBG-7) Length = 419 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -2 Query: 167 IYACHVRNSGSGLPLSKVGWVSVAFWS 87 +YAC VRNS +G SK V V+ W+ Sbjct: 391 LYACSVRNSATGKESSKSVTVRVSDWT 417
>VGLH_SHV21 (P16492) Glycoprotein H precursor| Length = 717 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = -3 Query: 253 LLLPDETLL*NVLHISHVIMSQDKGRRRSFMLVMFVIVAAACHCLKWVGFLLHFGQ 86 +LL +L +++H + + QD L+ +V+ ++ C L+ LLHFGQ Sbjct: 429 MLLDAYIVLNDIMHKNETVKKQD--------LLPYVLSSSMCTSLEIGNLLLHFGQ 476
>MOBA1_ECOLI (P08098) Mobilization protein A (Protein B)| Length = 529 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 Query: 188 RQRSQEIIYACHVRNSGSGLPLSKVGWVSVAFWSG 84 R ++ I C R + SGLP ++ GW+S W G Sbjct: 77 RTSTRTQIITCCSRLTCSGLPGARAGWLSGLCWRG 111
>PSG4_HUMAN (Q00888) Pregnancy-specific beta-1-glycoprotein 4 precursor| (PSBG-4) (PSBG-9) Length = 419 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 167 IYACHVRNSGSGLPLSKVGWVSVAFW 90 +YAC VRNS +G SK V V+ W Sbjct: 391 LYACSVRNSATGKESSKSITVKVSDW 416 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,442,604 Number of Sequences: 219361 Number of extensions: 734414 Number of successful extensions: 1947 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1947 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)