| Clone Name | rbastl09g04 |
|---|---|
| Clone Library Name | barley_pub |
>GUAA_HAEDU (Q7VLE9) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 523 Score = 28.9 bits (63), Expect = 3.2 Identities = 18/69 (26%), Positives = 32/69 (46%) Frame = +1 Query: 79 SRYTSLVAS*ALHLCYDTISLEAWRYKIHRKTLQRRN*VAVVLGTAPKSSTRVEHLHPIG 258 S+YT L+A + + E W + + K ++ N ++L P+S+T H Sbjct: 16 SQYTQLIARRIREI---GVYCELWAWDVTEKQIREFNPTGIILSGGPESTTETNSPHAPE 72 Query: 259 HMVIFKAAV 285 + +FKA V Sbjct: 73 Y--VFKAGV 79
>NU3M_XENLA (P03900) NADH-ubiquinone oxidoreductase chain 3 (EC 1.6.5.3) (NADH| dehydrogenase subunit 3) Length = 114 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -1 Query: 220 LVPFPELQQLNSSSVKFFYESCISRLLVRLYHSTGVMLSWLPG 92 L+PFP QLN+ S+ + + I LL + G++ WL G Sbjct: 71 LLPFPWAAQLNTPSIVILWAALILTLL-----TLGLIYEWLQG 108
>T10_MOUSE (P54797) Ser/Thr-rich protein T10 in DGCR region| Length = 276 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 291 IADGSFEDNHMTYRMQVFHSCAALWCRSQNY 199 + D + ED Y + + AA+WCR +Y Sbjct: 204 LPDPAIEDQGQEYVQPILNKYAAVWCRCASY 234
>VGLM_TSWVD (Q9IKB7) Envelope polyprotein precursor (M polyprotein) [Contains:| Glycoprotein G1; Glycoprotein G2] Length = 1135 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +2 Query: 293 QKCLA-PMVNQTSRCILGCNYLD 358 Q C+A P ++ +C LGC YLD Sbjct: 525 QNCIARPSIDNLIKCRLGCEYLD 547
>VGLM_TSWV1 (P36291) Envelope polyprotein precursor (M polyprotein) [Contains:| Glycoprotein G1; Glycoprotein G2] Length = 1135 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +2 Query: 293 QKCLA-PMVNQTSRCILGCNYLD 358 Q C+A P ++ +C LGC YLD Sbjct: 525 QNCIARPSIDNLIKCRLGCEYLD 547
>ANX11_COLLI (P14950) Annexin A1 isoform p35 (Annexin I isoform p35) (Lipocortin| I) (Calpactin II) (Chromobindin-9) (Phospholipase A2 inhibitory protein) Length = 341 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 174 FTEEELSCCSSGNGTKEQHKSGTLASYRSYGYLQSCR 284 F EEL C G+GT E LAS + ++CR Sbjct: 113 FDAEELRACMKGHGTDEDTLIEILASRNNKEIREACR 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,571,659 Number of Sequences: 219361 Number of extensions: 1007630 Number of successful extensions: 2082 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2082 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)