| Clone Name | rbastl09f02 |
|---|---|
| Clone Library Name | barley_pub |
>GPR33_MOUSE (O88416) Probable G-protein coupled receptor 33| Length = 339 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = -1 Query: 238 LSSVLSSFCQAAAATLVMSSQHWCFASIK*NAVTVELHYFVFPHLFFIAIINKNTFLL 65 LS +S+ AT + HW F S+ A L +F +FF++ I+ + L Sbjct: 72 LSYFISTLILPFMATSFLQDNHWVFGSVLCKAFNSTLSVSMFASVFFLSAISVARYYL 129
>GPR33_RATRT (Q49SP8) Probable G-protein coupled receptor 33| Length = 339 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = -1 Query: 238 LSSVLSSFCQAAAATLVMSSQHWCFASIK*NAVTVELHYFVFPHLFFIAIINKNTFLL 65 LS +S+ AT + HW F S+ L +F +FF++ I+ + + L Sbjct: 72 LSYFISTLILPFMATSFLQDNHWAFGSVLCKVFNSTLSVSMFASVFFLSAISVDRYHL 129
>NPBW2_HUMAN (P48146) Neuropeptides B/W receptor type 2 (G-protein coupled| receptor 8) Length = 333 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = -1 Query: 178 QHWCFASIK*NAVTVELHYFVFPHLFFIAIINKNTFLL 65 Q+W F + V HY +F ++F+A+++ + +L+ Sbjct: 108 QYWPFGELLCKLVLAVDHYNIFSSIYFLAVMSVDRYLV 145
>CHD2_HUMAN (O14647) Chromodomain-helicase-DNA-binding protein 2 (EC 3.6.1.-)| (ATP-dependent helicase CHD2) (CHD-2) Length = 1739 Score = 27.7 bits (60), Expect = 7.1 Identities = 15/54 (27%), Positives = 29/54 (53%) Frame = -2 Query: 357 SQQARRDPSRSSLVDIIASWETGGSPPRNFKAECSRTNKHYRLCYRPSAKQQQQ 196 S ++R++PSR ++ + +S GSP R + + + K + PS +Q+Q Sbjct: 112 SNRSRQEPSRFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQ---EPSEDEQEQ 162
>ORC2_YEAST (P32833) Origin recognition complex subunit 2 (Origin recognition| complex protein 71 kDa subunit) Length = 620 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 305 PHGKQVVHRQEISRRNALERINII 234 PHG++ + R S++N LERI+++ Sbjct: 30 PHGERQLRRIHSSKKNLLERISLV 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,223,341 Number of Sequences: 219361 Number of extensions: 896576 Number of successful extensions: 1958 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1958 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)