| Clone Name | rbastl09b12 |
|---|---|
| Clone Library Name | barley_pub |
>INO80_NEUCR (Q872I5) Putative DNA helicase ino-80 (EC 3.6.1.-)| Length = 2001 Score = 30.4 bits (67), Expect = 1.0 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = +3 Query: 42 SYRHSAQHHYPDTRHIAHTHMIPPWTSN*SSTQTEPSIQPSLGMPLVVQ---SLELGVSG 212 S +H QHH+P+ A +PP SS Q P+I P G+ SL L G Sbjct: 176 SQQHQQQHHHPNPFVAASAPSLPPPP---SSLQAPPAITPIAGLSAPAPASGSLPLSAGG 232 Query: 213 I 215 I Sbjct: 233 I 233
>KN1_MAIZE (P24345) Homeotic protein knotted-1| Length = 359 Score = 29.6 bits (65), Expect = 1.8 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +3 Query: 18 QHF*TCKHSYRHS-AQHHYPDTRHIAHTHMIPPWTSN*SSTQTE-PSIQPSLGMPLVVQS 191 QHF S+ H QHH+ H H PW S+ S+ P PS G+PL + + Sbjct: 6 QHFGVGASSHGHGHGQHHH-------HHHHHHPWASSLSAVVAPLPPQPPSAGLPLTLNT 58 Query: 192 L 194 + Sbjct: 59 V 59
>MTRM_DROYA (P83733) Protein matrimony (Cell cycle arrest protein D52)| Length = 219 Score = 28.1 bits (61), Expect = 5.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 39 HSYRHSAQHHYPDTRHIAHTHMIPP 113 H + H QHH+ +HI T + PP Sbjct: 79 HPHPHQHQHHHHHHKHIHRTQLKPP 103
>CR023_HUMAN (Q8NB54) Protein C18orf23| Length = 160 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -2 Query: 153 CWVPFAYCFSYSSREESCVCGRYALYQDNGVVRCACSCVCTF 28 C P YC ++ + +C+C A + C C CVC + Sbjct: 26 CASPLCYCPAHPA-PRNCLCMTVAYTGSRCLGACVCVCVCLY 66
>YRO7_CAEEL (Q09424) Hypothetical protein R07G3.7| Length = 366 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 45 YRHSAQHHYPDTRHIAH 95 Y+HS QHH P R I+H Sbjct: 271 YKHSVQHHKPIKRDISH 287
>MUTYH_RAT (Q8R5G2) A/G-specific adenine DNA glycosylase (EC 3.2.2.-) (MutY| homolog) (rMYH) Length = 516 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 212 DQREQELGTSLVAPQLPL-HFCPCSALLRLH 301 +Q ELG ++ PQ PL + CP +L R H Sbjct: 250 NQAAMELGATVCTPQRPLCNHCPVQSLCRAH 280
>TMM28_HUMAN (O75949) Transmembrane protein 28 (TED protein)| Length = 473 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +3 Query: 30 TCKHSYRHSAQHHYPDTRHIAHTHMIPPWTSN*SSTQTEPSIQPSLG 170 T + + HS HHY H H H PP +P++ P G Sbjct: 382 THQQQFHHSYFHHYHQQYHHYHPHHDPP-----GRVSNKPALLPVSG 423
>ARI1B_HUMAN (Q8NFD5) AT-rich interactive domain-containing protein 1B (ARID| domain-containing protein 1B) (Osa homolog 2) (hOsa2) (p250R) (BRG1-binding protein hELD/OSA1) (BRG1-associated factor 250b) (BAF250B) Length = 2236 Score = 27.3 bits (59), Expect = 8.9 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 36 KHSYRHSAQHHYPDTRHIAHTHMI 107 +H + H A HH+ H+ H H + Sbjct: 83 QHHHHHHAHHHHHHAHHLHHHHAL 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,034,394 Number of Sequences: 219361 Number of extensions: 946729 Number of successful extensions: 2701 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2685 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)