| Clone Name | rbastl06h12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GID_BACSK (Q5WFP8) tRNA uridine 5-carboxymethylaminomethyl modif... | 29 | 3.6 | 2 | GID_STAES (Q8CPH2) tRNA uridine 5-carboxymethylaminomethyl modif... | 28 | 4.8 | 3 | GID_STAEQ (Q5HPU1) tRNA uridine 5-carboxymethylaminomethyl modif... | 28 | 4.8 | 4 | RLM1_YEAST (Q12224) Transcription factor RLM1 | 28 | 6.2 |
|---|
>GID_BACSK (Q5WFP8) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 436 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = -2 Query: 176 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 18 + L C +L+G +L N V +L H D + G + +D +D Sbjct: 50 AELVCSNSLRGNSLANAVGVLKEEMRHLDSVIIKAADEAAVPAGGALAVDRHD 102
>GID_STAES (Q8CPH2) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 435 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = -2 Query: 176 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 18 + L C +L+G AL N V +L H D + G + +D +D Sbjct: 48 AELVCSNSLRGNALTNAVGVLKEEMRHLDSLIITSADKARVPAGGALAVDRHD 100
>GID_STAEQ (Q5HPU1) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 435 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/53 (26%), Positives = 22/53 (41%) Frame = -2 Query: 176 SRLTCGRNLKGTALINTVDILYTRAGHFDGAFLHCKTSVTACTYGDVILDVND 18 + L C +L+G AL N V +L H D + G + +D +D Sbjct: 48 AELVCSNSLRGNALTNAVGVLKEEMRHLDSLIITSADKARVPAGGALAVDRHD 100
>RLM1_YEAST (Q12224) Transcription factor RLM1| Length = 676 Score = 28.1 bits (61), Expect = 6.2 Identities = 22/73 (30%), Positives = 32/73 (43%) Frame = +2 Query: 38 HLHKYKPLLKFYSVKMPRQNDQRVCIKYLPC*SMPCLSNSYHRSAYSAGGARLSTMSGPF 217 HL + KP S +Q Q + S P S+ Y+ + S+ + STM P Sbjct: 191 HLKRLKPDPLQISRTPQQQQQQNI--------SRPYHSSMYNLNQPSSSSSSPSTMDFPK 242 Query: 218 SPATENSSGTGTP 256 P+ +NSS G P Sbjct: 243 LPSFQNSSFNGRP 255 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,465,547 Number of Sequences: 219361 Number of extensions: 590091 Number of successful extensions: 1841 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1838 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)