| Clone Name | rbastl06f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PLCB4_BOVIN (Q07722) 1-phosphatidylinositol-4,5-bisphosphate pho... | 28 | 5.4 | 2 | ACPS_LEPIN (Q8F136) Holo-[acyl-carrier-protein] synthase (EC 2.7... | 28 | 7.1 | 3 | ACPS_LEPIC (Q72U18) Holo-[acyl-carrier-protein] synthase (EC 2.7... | 28 | 7.1 |
|---|
>PLCB4_BOVIN (Q07722) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| beta 4 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (Phospholipase C-beta-4) (PLC-beta-4) (PCL-C1) (Fragment) Length = 1023 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 368 EHKSSRHKLPVQIQRITSCYAHAHLLHDKIMEKPAKK 258 EH + + Q+ +I + Y L H+KI+EK KK Sbjct: 797 EHSTMQKLHCTQVDKIVAQYDKEKLTHEKILEKAMKK 833
>ACPS_LEPIN (Q8F136) Holo-[acyl-carrier-protein] synthase (EC 2.7.8.7)| (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) Length = 126 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 Query: 231 ADRRDPIPHLLGRF 272 ++R+DPIPHL GRF Sbjct: 40 SNRKDPIPHLSGRF 53
>ACPS_LEPIC (Q72U18) Holo-[acyl-carrier-protein] synthase (EC 2.7.8.7)| (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) Length = 126 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +3 Query: 231 ADRRDPIPHLLGRF 272 ++R+DPIPHL GRF Sbjct: 40 SNRKDPIPHLSGRF 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,456,723 Number of Sequences: 219361 Number of extensions: 563655 Number of successful extensions: 799 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)