| Clone Name | rbastl06c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SNX19_HUMAN (Q92543) Sorting nexin-19 | 29 | 3.4 |
|---|
>SNX19_HUMAN (Q92543) Sorting nexin-19| Length = 992 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/62 (25%), Positives = 22/62 (35%) Frame = -3 Query: 211 ENGRAWVTFCSAALNHPISHIPGCLCTYKLIIARALQLGHKYSNRLARDSPAYILAELYL 32 E W +C A HP H P TY + L G L + +++ EL Sbjct: 184 EPSHLWEAYCRATAPHPAVHSPSAEVTYTRGVVNLLLQGLVPKPHLETRTGRHVVVELIT 243 Query: 31 VN 26 N Sbjct: 244 CN 245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,400,268 Number of Sequences: 219361 Number of extensions: 902744 Number of successful extensions: 1495 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1495 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)