| Clone Name | rbastl06c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FAL1_CRYNE (Q5KJJ2) ATP-dependent RNA helicase FAL1 (EC 3.6.1.-) | 28 | 6.6 | 2 | MATK_APOAN (O09410) Maturase K (Intron maturase) | 28 | 8.6 |
|---|
>FAL1_CRYNE (Q5KJJ2) ATP-dependent RNA helicase FAL1 (EC 3.6.1.-)| Length = 396 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -2 Query: 76 LAVCFEIIVMHVNDYIIVTCNACI 5 LAV + +V+ + DY+ V+C+ACI Sbjct: 103 LAVQIQTVVLALGDYMNVSCHACI 126
>MATK_APOAN (O09410) Maturase K (Intron maturase)| Length = 505 Score = 27.7 bits (60), Expect = 8.6 Identities = 14/60 (23%), Positives = 31/60 (51%) Frame = +2 Query: 23 YNNIVVNMHDNNFKAYSQIRRTAYILQNMSHEFEIIFYMQLMS*SPARILRTYVKNIYIL 202 + + +VN NF + RR AYI Q ++ + + Y+ ++ +P + +KN +++ Sbjct: 297 WKSYLVNFWQCNFDLWVHSRR-AYIKQVYNYSLDFMGYLSIVRQTPLTVRSQMLKNAFLI 355 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,720,322 Number of Sequences: 219361 Number of extensions: 429412 Number of successful extensions: 735 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 735 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)