| Clone Name | rbastl05a02 |
|---|---|
| Clone Library Name | barley_pub |
>ATU2_YEAST (P38995) Copper-transporting ATPase (EC 3.6.3.4) (Cu(2+)-ATPase)| Length = 1004 Score = 32.3 bits (72), Expect = 0.29 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +1 Query: 82 ERNRSQLTTCYNLQGTIE-RTVTHHDDTRTWQTTILMSTSLQVTLILLHPA*PFLW 246 ER + T NL T + R ++ D+ R W+ + ST L + +LL+ P +W Sbjct: 224 ERTGYKFTVFSNLDNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMW 279
>DNAJ_MYCH2 (Q601X8) Chaperone protein dnaJ| Length = 368 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 22 ISQS*IKCD*SRCIKLPGKNERNRSQLTTCYNLQG 126 ISQ K D +C G + S +TTCYN QG Sbjct: 142 ISQKLTKYD--QCDNCKGSGANSSSDITTCYNCQG 174
>ZBTB5_HUMAN (O15062) Zinc finger and BTB domain-containing protein 5| Length = 677 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 168 CSCIIVMGNRSFDCTL*VVACC 103 C C+IV+GNR F V+A C Sbjct: 24 CDCVIVVGNRHFKAHRSVLAAC 45
>ZBTB5_MOUSE (Q7TQG0) Zinc finger and BTB domain-containing protein 5| (Transcription factor ZNF-POZ) Length = 670 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 168 CSCIIVMGNRSFDCTL*VVACC 103 C C+IV+GNR F V+A C Sbjct: 24 CDCVIVVGNRHFKAHRSVLAAC 45
>YGI8_YEAST (P53151) Hypothetical 14.2 kDa protein in MFAL2-MAD1 intergenic| region Length = 121 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 227 GCNSISVTCRLVDIRI 180 GCNS+SV C L D+R+ Sbjct: 100 GCNSLSVVCFLADLRV 115
>TNAP3_MOUSE (Q60769) Tumor necrosis factor, alpha-induced protein 3 (EC| 3.-.-.-) (Putative DNA binding protein A20) (Zinc finger protein A20) Length = 775 Score = 28.1 bits (61), Expect = 5.5 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%) Frame = -1 Query: 243 QKGLSWV*QY*R--NL*TSGH*NCCLPCSCIIVMGNRSFDCTL*VVACCELRSVP---FI 79 QK L+W + + L T+G NC + +C + G + D L C L+ F Sbjct: 80 QKKLNWCREVRKLVALKTNGDGNCLMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFK 139 Query: 78 FTWEFNATRSITF 40 F W+ + +S F Sbjct: 140 FRWQLESLKSQEF 152
>LEU2_PROMT (Q46HB8) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 469 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 272 QSVPNQRFKALQEQGNDKQACQLMNLK 352 +++PN F EQ K AC+ MNLK Sbjct: 303 ETIPNPEFLPKNEQQIAKDACKYMNLK 329
>MUTL_NEIMB (Q9JYT2) DNA mismatch repair protein mutL| Length = 658 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 213 NTVTPSLTLFVDEPMKYFRFKVYPIRDSRLYRNRATISRLV 335 N +TP+ LF+D P + V+P + +R+ + +LV Sbjct: 277 NALTPAFVLFLDLPPEAVDVNVHPTKTEIRFRDSQQVHQLV 317
>MUTL_NEIMA (Q9JTS2) DNA mismatch repair protein mutL| Length = 658 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 213 NTVTPSLTLFVDEPMKYFRFKVYPIRDSRLYRNRATISRLV 335 N +TP+ LF+D P + V+P + +R+ + +LV Sbjct: 277 NALTPAFVLFLDLPPEAVDVNVHPTKTEIRFRDSRQVHQLV 317
>PADI6_HUMAN (Q6TGC4) Protein-arginine deiminase type-6 (EC 3.5.3.15)| (Protein-arginine deiminase type VI) (Peptidylarginine deiminase VI) Length = 686 Score = 27.3 bits (59), Expect = 9.3 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 12/49 (24%) Frame = -1 Query: 180 CCLP---CSCIIVMGNR-----SFDCTL*VV----ACCELRSVPFIFTW 70 CCL C + +G + FDC L V AC +R VPF F W Sbjct: 633 CCLEEKICCLLEPLGFKCTFINDFDCYLTEVGDICACANIRRVPFAFKW 681 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,050,784 Number of Sequences: 219361 Number of extensions: 851484 Number of successful extensions: 1722 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)