| Clone Name | rbastl04g05 |
|---|---|
| Clone Library Name | barley_pub |
>S23A1_RAT (Q9WTW7) Solute carrier family 23 member 1 (Sodium-dependent| vitamin C transporter 1) (Na(+)/L-ascorbic acid transporter 1) Length = 604 Score = 29.6 bits (65), Expect = 3.2 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -1 Query: 284 PWIPIPYPCSW 252 PWI IPYPC W Sbjct: 308 PWIRIPYPCQW 318
>DAPF_CLOAB (Q97FV2) Diaminopimelate epimerase (EC 5.1.1.7) (DAP epimerase)| Length = 333 Score = 29.6 bits (65), Expect = 3.2 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +2 Query: 110 TKEASEWLK*ITSVQGGIMLLYMIFTAAHVMVKSLPLNYTKQRLL 244 T ++ W+K + G+ + + + + VK+LPLNY K++L+ Sbjct: 112 TLKSKYWVKLQEDIYEGVKTVKIDIKSVSLDVKTLPLNYKKEKLI 156
>S23A1_HUMAN (Q9UHI7) Solute carrier family 23 member 1 (Sodium-dependent| vitamin C transporter 1) (hSVCT1) (Na(+)/L-ascorbic acid transporter 1) (Yolk sac permease-like molecule 3) Length = 598 Score = 29.6 bits (65), Expect = 3.2 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -1 Query: 284 PWIPIPYPCSW 252 PWI IPYPC W Sbjct: 301 PWIRIPYPCQW 311
>S23A1_MOUSE (Q9Z2J0) Solute carrier family 23 member 1 (Sodium-dependent| vitamin C transporter 1) (Na(+)/L-ascorbic acid transporter 1) (Yolk sac permease-like molecule 3) Length = 605 Score = 29.6 bits (65), Expect = 3.2 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -1 Query: 284 PWIPIPYPCSW 252 PWI IPYPC W Sbjct: 308 PWIRIPYPCQW 318
>ACET_RAT (Q8CFN1) Angiotensin-converting enzyme, testis-specific isoform| precursor (EC 3.4.15.1) (EC 3.2.1.-) (ACE-T) (Dipeptidyl carboxypeptidase I) (Kininase II) [Contains: Angiotensin-converting enzyme, testis-specific isoform, soluble form] Length = 775 Score = 28.5 bits (62), Expect = 7.1 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = -2 Query: 280 GSPFHIHVVGTE*QTLFGVV*RQRFHHDMCSCENHVQEHYSPLYTCDLFE--PLGGFLCN 107 GS FH+ + + + +FH +C H PLY CD+++ G L + Sbjct: 582 GSKFHVPANVPYIRYFISFIIQFQFHEALCRAAGHT----GPLYKCDIYQSKEAGKLLAD 637 Query: 106 TLVFVYS 86 + YS Sbjct: 638 AMKLGYS 644
>YIDL_ECOLI (P31449) Putative HTH-type transcriptional regulator yidL| Length = 307 Score = 28.5 bits (62), Expect = 7.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -2 Query: 178 HVQEHYSPLYTCDLFEPLGGFLCNTLVFVYSVKASAKINMVHTMALAAHGRAF*F 14 + EHY ++ D +PL + N+ V VY+V+ KI + + + HG F Sbjct: 50 YADEHYRVIWPRDKKKPL---IANSWVAVYTVQGCGKILLKNGEQITLHGNCIIF 101
>C1QR1_HUMAN (Q9NPY3) Complement component C1q receptor precursor (Complement| component 1, q subcomponent, receptor 1) (C1qR) (C1qRp) (C1qR(p)) (C1q/MBL/SPA receptor) (CD93 antigen) (CDw93) Length = 652 Score = 28.5 bits (62), Expect = 7.1 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 422 GGDASFLCILPSTWRLLAAVFFCYN*RHRCSSCSGKGRVT 303 GGD SFLC +RLL + C + R+ CSS +G T Sbjct: 278 GGDGSFLCGCRPGFRLLDDLVTCAS-RNPCSSSPCRGGAT 316
>ACE_RAT (P47820) Angiotensin-converting enzyme, somatic isoform precursor (EC| 3.4.15.1) (Dipeptidyl carboxypeptidase I) (Kininase II) [Contains: Angiotensin-converting enzyme, somatic isoform, soluble form] Length = 1313 Score = 28.5 bits (62), Expect = 7.1 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = -2 Query: 280 GSPFHIHVVGTE*QTLFGVV*RQRFHHDMCSCENHVQEHYSPLYTCDLFE--PLGGFLCN 107 GS FH+ + + + +FH +C H PLY CD+++ G L + Sbjct: 1120 GSKFHVPANVPYIRYFISFIIQFQFHEALCRAAGHT----GPLYKCDIYQSKEAGKLLAD 1175 Query: 106 TLVFVYS 86 + YS Sbjct: 1176 AMKLGYS 1182
>ADA33_HUMAN (Q9BZ11) ADAM 33 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 33) Length = 813 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 170 LYMIFTAAHVMVKSLPLNYTKQRLLLCTNYMD 265 LY++ + + LN+TKQRLL NY+D Sbjct: 214 LYIVADHTLFLTRHRNLNHTKQRLLEVANYVD 245
>ST14_HUMAN (Q9Y5Y6) Suppressor of tumorigenicity protein 14 (EC 3.4.21.-)| (Serine protease 14) (Matriptase) (Membrane-type serine protease 1) (MT-SP1) (Prostamin) (Serine protease TADG-15) (Tumor-associated differentially-expressed gene 15 protein) Length = 855 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -1 Query: 338 RCSSCSGKGRVTRRTYPMPWIPIPYP----CSW 252 R SSC G+ R + T+ P+ P YP C+W Sbjct: 336 RMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTW 368
>DNAJ_BACHD (Q9KD71) Chaperone protein dnaJ| Length = 370 Score = 28.1 bits (61), Expect = 9.2 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = -1 Query: 344 RHRCSSCSGKGRVTRR 297 +H+C++C GKG+V +R Sbjct: 195 KHKCATCGGKGKVRKR 210
>PLMN_MACEU (O18783) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 806 Score = 28.1 bits (61), Expect = 9.2 Identities = 18/67 (26%), Positives = 25/67 (37%), Gaps = 19/67 (28%) Frame = +1 Query: 34 GQPRPWCA---PY*SWRM---------------LLHCTQTQ-VYYKGSLRVAQINHKCTR 156 G+PRPWC P W +L C + + Y+G + V + H C R Sbjct: 239 GEPRPWCFTSNPEKRWEFCNIPRCSSPPPPPGPMLQCLKGRGENYRGKIAVTKSGHTCQR 298 Query: 157 GNNALVH 177 N H Sbjct: 299 WNKQTPH 305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,430,657 Number of Sequences: 219361 Number of extensions: 1458129 Number of successful extensions: 3532 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3530 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)