| Clone Name | rbastl04f05 |
|---|---|
| Clone Library Name | barley_pub |
>OLP1_LYCES (Q41350) Osmotin-like protein precursor| Length = 252 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -2 Query: 330 CGAVINKRIKS-RGEVIGCCSLCWKGKSDRHCC 235 C AV+ R G V+GC S C KSD CC Sbjct: 168 CPAVLQFRSHGGHGPVVGCKSACEAFKSDEFCC 200
>HEBP1_PIG (Q5ISC6) Heme-binding protein 1| Length = 189 Score = 27.3 bits (59), Expect = 9.7 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +1 Query: 91 RFATTKYLDTFAKHVLTESQPQQLF***YHQMLINYPGGSKNPFILLSTTVPVALA-FPT 267 +FAT + D L E+ P+ ++ Y GGS + I + TVP++ A FP+ Sbjct: 40 KFATVEMTDKPVDEALREAMPK----------VMKYVGGSNDKGIGMGMTVPISFAVFPS 89
>5HT1R_DROME (P20905) 5-hydroxytryptamine receptor 1 (5-HT receptor) (Serotonin| receptor 1) (5HT-dro) Length = 564 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -3 Query: 200 G*LISIWWYYY*NSCCGCDSVNTCLANVSRYLVVAK 93 G L+ W + CC +N C +V RYL + K Sbjct: 231 GPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITK 266
>FBN1_PIG (Q9TV36) Fibrillin-1 precursor| Length = 2871 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -3 Query: 134 TCLANVSRYLVVAKRVNGFFSSVYKEENGKNNGMVCLEFPKK 9 T L N +RYL+ + NGFF KE G+ L F KK Sbjct: 2785 TTLTNHNRYLIESGNENGFFKINQKE------GISYLHFTKK 2820
>FBN1_BOVIN (P98133) Fibrillin-1 precursor (MP340)| Length = 2871 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -3 Query: 134 TCLANVSRYLVVAKRVNGFFSSVYKEENGKNNGMVCLEFPKK 9 T L N +RYL+ + NGFF KE G+ L F KK Sbjct: 2785 TTLTNHNRYLIESGNENGFFKINQKE------GISYLHFTKK 2820
>5HT6R_RAT (P31388) 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin| receptor 6) (ST-B17) Length = 436 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 191 ISIWWYYY*NSCCGCDSVNTCLANVSRYLVV 99 + + W + CC +N CL ++ RYL++ Sbjct: 98 LCLLWTAFDVMCCSASILNLCLISLDRYLLI 128
>5HT6R_PANTR (Q5IS65) 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin| receptor 6) Length = 440 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 191 ISIWWYYY*NSCCGCDSVNTCLANVSRYLVV 99 + + W + CC +N CL ++ RYL++ Sbjct: 98 LCLLWTAFDVMCCSASILNLCLISLDRYLLI 128
>5HT6R_MOUSE (Q9R1C8) 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin| receptor 6) Length = 440 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 191 ISIWWYYY*NSCCGCDSVNTCLANVSRYLVV 99 + + W + CC +N CL ++ RYL++ Sbjct: 98 LCLLWTAFDVMCCSASILNLCLISLDRYLLI 128
>5HT6R_HUMAN (P50406) 5-hydroxytryptamine 6 receptor (5-HT-6) (Serotonin| receptor 6) Length = 440 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 191 ISIWWYYY*NSCCGCDSVNTCLANVSRYLVV 99 + + W + CC +N CL ++ RYL++ Sbjct: 98 LCLLWTAFDVMCCSASILNLCLISLDRYLLI 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,568,547 Number of Sequences: 219361 Number of extensions: 816325 Number of successful extensions: 2006 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2006 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)