| Clone Name | rbastl04c10 |
|---|---|
| Clone Library Name | barley_pub |
>ROK1_NEUCR (Q7SFC8) ATP-dependent RNA helicase rok-1 (EC 3.6.1.-)| Length = 781 Score = 32.0 bits (71), Expect = 0.37 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +2 Query: 38 TDEKEEKNSTPRLKRNKKQNMEQDKRTKKKE*PKQIY 148 T+EK K + + KKQ E+ K+ KK E KQIY Sbjct: 139 TEEKPPKKQKKQKEDRKKQEEEEKKKKKKDEDKKQIY 175
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 44 EKEEKNSTPRLKRNKKQNMEQDKRTKKK 127 + EE+ S RLKR +K+ E++KR KK Sbjct: 93 DSEEEKSHRRLKRKRKKEREKEKRRSKK 120
>CBF5_KLULA (O13473) Centromere/microtubule-binding protein CBF5| (Centromere-binding factor 5) (Small nucleolar RNP protein CBF5) (H/ACA snoRNP protein CBF5) Length = 474 Score = 29.3 bits (64), Expect = 2.4 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +2 Query: 41 DEKEEKNSTPRLKRNKKQNMEQDKRTKKKE 130 +E +E++ TP K++KK+ E+ + +KKE Sbjct: 419 EESKEESKTPEEKKDKKEKKEKKDKKEKKE 448
>CJ084_MOUSE (Q8C6C7) Protein C10orf84 homolog| Length = 236 Score = 28.9 bits (63), Expect = 3.1 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 50 EEKNSTPRLKRNKKQNMEQDKRTKKKE 130 E+KNSTPR ++ K++ ++ K +KE Sbjct: 92 EQKNSTPRFRQKKRKRSKKGKLKNEKE 118
>CS007_HUMAN (Q9UPT8) Zinc finger CCCH-type domain-containing protein C19orf7| Length = 1303 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 44 EKEEKNSTPRLKRNKKQNMEQDKRTKKK 127 + +E+ S RLKR +K+ E++KR KK Sbjct: 93 DSDEEKSHRRLKRKRKKEREKEKRRSKK 120
>NOC2L_MOUSE (Q9WV70) Nucleolar complex protein 2 homolog (NOC2 protein homolog)| Length = 747 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 335 CLWRWCRGWEYILIYETNHHLHFLLPQMILNLARLIPFVRHY 210 CL+ WCR + E L + L Q+I+ +L+P R Y Sbjct: 412 CLYLWCRVLSTLGSSEILQPLLYPLSQIIIGCIKLLPTARFY 453
>KSGA_ZYMMO (Q5NMX2) Dimethyladenosine transferase (EC 2.1.1.-)| (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) Length = 278 Score = 28.5 bits (62), Expect = 4.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 165 LSFPVYRSIFLSPPTIM 215 LSFPV+RS F+ PP +M Sbjct: 182 LSFPVHRSAFVPPPKVM 198
>POLR_KYMVJ (P36304) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1874 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 257 QMILNLARLIPFVRHYCW 204 Q+ RL+PF+ HYCW Sbjct: 1113 QLQSETTRLLPFIDHYCW 1130
>CYB_TRYBO (Q33568) Cytochrome b| Length = 372 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -2 Query: 335 CLWRWCRGWEYILIYETNHHLHFLLPQMILNLARLIPFVRHY 210 C W WC + H +H LP ++L L FV HY Sbjct: 163 CQWIWCSEFINDFTLLKLHSIHIFLPFVLLFLIGAHFFVLHY 204
>H11_VOLCA (Q08864) Histone H1-I| Length = 260 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 35 VTDEKEEKNSTPRLKRNKKQNMEQDKRTKKKE*PKQ 142 V K K R K+ KK+ +E+ K T K E PK+ Sbjct: 163 VKKTKAPKEKVERPKKEKKEKVEKKKATPKAEKPKK 198
>DPOM_NEUCR (P33537) Probable DNA polymerase (EC 2.7.7.7)| Length = 1021 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 159 SYLSFPVYRSIFLSPPTIMPNERN*PS*IKNHLRKKKMKMM 281 S L+F VYR+IFL NE N P+ I + KK+ K + Sbjct: 548 SALAFLVYRTIFLPNEVEEENETNSPNNILSLFDKKEEKKL 588
>CHS5_YEAST (Q12114) Chitin biosynthesis protein CHS5 (Protein CAL3)| Length = 671 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 35 VTDEKEEKNSTPRLKRNKKQNMEQDKRTKKK 127 V KE K +T NKK+N + K+ KKK Sbjct: 641 VLSTKEAKKNTGNSNSNKKKNKKNKKKGKKK 671
>PFPC_ENTHI (Q24825) Pore-forming peptide ameobapore C precursor (EH-APP)| Length = 101 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 2 YMYVCMFLLCLVTDEKEEKNSTPRL 76 ++ +C+F+LCL + EK++ P L Sbjct: 4 FVLLCVFVLCLASQEKQQDREIPVL 28 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,418,422 Number of Sequences: 219361 Number of extensions: 643618 Number of successful extensions: 2240 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2231 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)