| Clone Name | rbastl04c07 |
|---|---|
| Clone Library Name | barley_pub |
>RFX1_HUMAN (P22670) MHC class II regulatory factor RFX1 (RFX) (Enhancer factor| C) (EF-C) Length = 979 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +1 Query: 121 DSATSVSATRP------RLHVRKLQQGLPVPGARRVLVYRPQKPRPG 243 +S++S +A P +L V +QQ +PV R V+ PQ P+PG Sbjct: 214 NSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPG 260
>CN102_MOUSE (Q80XC6) Protein C14orf102 homolog| Length = 1172 Score = 28.9 bits (63), Expect = 3.1 Identities = 23/84 (27%), Positives = 36/84 (42%), Gaps = 12/84 (14%) Frame = -1 Query: 399 EKNLRLEWFSWPPELRPAELYFQMHLLASQSTAVLA-GPQQRKQQQLVETMQSPGAWLLR 223 E N R+ W +L A + FQ ++ S L G Q++ ++ L ++ A L R Sbjct: 322 EFNRRVRENPWDTQLWMAFVAFQDEVMRSPGIYALGEGEQEKHRKSLKLLLEKKLAVLER 381 Query: 222 AIHQNPS-----------CSRYWK 184 AI NP CS +W+ Sbjct: 382 AIESNPGSVELKLAKLQLCSEFWE 405
>7LESS_DROVI (P20806) Protein sevenless (EC 2.7.10.1)| Length = 2594 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -1 Query: 390 LRLEWFSWPPELRPAELYFQMHLLASQSTAVLAGPQQRKQQQLVET 253 L L W + P ELR A +Y+ +H +Q Q+Q VET Sbjct: 1835 LELSWLA-PLELRSASVYYTLHWQLQLEDTEEQSQEQPAQEQRVET 1879
>IAP2_NPVOP (O10324) Probable apoptosis inhibitor 2 (IAP-2)| Length = 236 Score = 28.5 bits (62), Expect = 4.0 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 10/75 (13%) Frame = +2 Query: 74 AKRSTRHKLRYNCVKLI--LLRPSQLQDRGYT--------YASCSKAFQYLEHDGFWCIA 223 A+R RH CV I L+ L+ R + + S ++ L GF+C+ Sbjct: 59 ARRVKRHTYSDTCVSAINALVANESLRKRSFASFKWARRQFGSRAREVDMLSRRGFYCVG 118 Query: 224 LRSHAPGLCIVSTSC 268 R G C V T+C Sbjct: 119 KRLRCAG-CKVVTTC 132
>PCD17_HUMAN (O14917) Protocadherin-17 precursor (Protocadherin-68)| Length = 889 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 266 CCCFLCWGPAST 301 CCCFL W PA T Sbjct: 6 CCCFLLWAPALT 17
>CTR1_OCTVU (Q7YW31) Cephalotocin receptor 1 (OT/VP superfamily peptide| receptor-1) (OC/CE-R 1) Length = 397 Score = 28.1 bits (61), Expect = 5.2 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 254 VSTSCCCFLCWGPASTAVDWLA 319 +S CCF+CW P W A Sbjct: 298 LSVVACCFICWSPFFVCQMWAA 319
>GRN_HUMAN (P28799) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B); Granulin-4 (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granul Length = 593 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 203 DGFWCIALRSHAPGLCIVSTSCCC--FLCWGPASTAVDWLASRCIWK 337 DG C L S G C + + CC L P T D + S+C+ K Sbjct: 217 DGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSK 263
>ZFH1_DROME (P28166) Zinc finger protein 1 (Zinc finger homeodomain protein 1)| Length = 1054 Score = 27.7 bits (60), Expect = 6.8 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -1 Query: 366 PPELRP---AELYFQMHLLASQSTAVLAGPQQRKQQQLVETMQ 247 PP+L P A+ LA QS + P Q++QQQL + Q Sbjct: 191 PPQLPPHLHAQFMAAAASLAMQSARTASSPSQQQQQQLQQQQQ 233
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 27.7 bits (60), Expect = 6.8 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +2 Query: 125 LLRPSQLQDRGYTYASCSKAFQYLEHDGFWCIALRSHAPGLCIVSTSCCCFLCWGPASTA 304 LL+P+ Q+ G +C+ + G+ C+ + + C + C F P ST Sbjct: 303 LLQPNACQNGG----TCTN-----RNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTC 353 Query: 305 VDWLAS-RCIWK*SSAG 352 +D +AS C+ AG Sbjct: 354 IDRVASFSCLCPEGKAG 370
>KCNAB_DROME (P17970) Potassium voltage-gated channel protein Shab| Length = 985 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 306 STGSPAGAFGSRARQAAVLGAKRTTRGEGS 395 S G PAGA GS A A GA T G G+ Sbjct: 146 SAGLPAGAVGSGAGAGAGAGASVTGSGSGA 175
>EPCR_BOVIN (Q28105) Endothelial protein C receptor precursor (Endothelial cell| protein C receptor) (Activated protein C receptor) (APC receptor) Length = 241 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -1 Query: 306 TAVLAGPQQRKQQQLVETMQSPGAWLLRAIHQNPSCSRYWKALLQLAYV 160 T VL GP + Q ++ +Q P +W L I+ N RY + + L V Sbjct: 57 THVLEGPGRNVSIQQLQPLQEPDSWALTKIYLN----RYLEEFVGLVQV 101
>BNK_DROME (P40794) Protein bottleneck| Length = 303 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 52 QSTSWAHSKEVYTTQITLQLR*TDSATSVSATRPRLH 162 Q T + K +T+Q+ ++L T+ +S RP+LH Sbjct: 48 QPTITSTPKPRFTSQLAVELAKTEPGNGISPLRPKLH 84
>POLG_KUNJM (P14335) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3433 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 128 LRPSQLQDRGYTYASCSKAFQYL 196 ++ +LQ +G TY CSKAF++L Sbjct: 580 VKMEKLQLKGTTYGVCSKAFRFL 602
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 27.3 bits (59), Expect = 8.9 Identities = 17/66 (25%), Positives = 30/66 (45%) Frame = +2 Query: 125 LLRPSQLQDRGYTYASCSKAFQYLEHDGFWCIALRSHAPGLCIVSTSCCCFLCWGPASTA 304 LL+P+ Q+ G +C+ + G+ C+ + + C + C F P ST Sbjct: 303 LLQPNACQNGG----TCAN-----RNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTC 353 Query: 305 VDWLAS 322 +D +AS Sbjct: 354 IDRVAS 359 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,968,858 Number of Sequences: 219361 Number of extensions: 975607 Number of successful extensions: 3304 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3302 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)