| Clone Name | rbastl04c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ABFA_BACSU (P94531) Alpha-N-arabinofuranosidase 1 (EC 3.2.1.55) ... | 31 | 1.2 | 2 | MY18A_MOUSE (Q9JMH9) Myosin-18A (Myosin XVIIIa) (Myosin containi... | 29 | 6.0 | 3 | PRIA_ECOLI (P17888) Primosomal protein N' (EC 3.6.1.-) (ATP-depe... | 29 | 6.0 |
|---|
>ABFA_BACSU (P94531) Alpha-N-arabinofuranosidase 1 (EC 3.2.1.55) (Arabinosidase| 1) Length = 500 Score = 31.2 bits (69), Expect = 1.2 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +2 Query: 83 LSLTMDHHKERKKLQCLAIFCIMTTQLVPKKGKEWTWQPLIYHHIASRLVPR 238 L +TM H +R K+ CLA + ++ +KG E QP+ Y ++ + + R Sbjct: 331 LLITMLQHADRVKIACLAQLVNVIAPIMTEKGGEAWRQPIFYPYMHASVYGR 382
>MY18A_MOUSE (Q9JMH9) Myosin-18A (Myosin XVIIIa) (Myosin containing PDZ domain)| (Molecule associated with JAK3 N-terminus) (MAJN) Length = 2035 Score = 28.9 bits (63), Expect = 6.0 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = +2 Query: 56 HCTTYRYQLLSLTMDHHKERKKLQCLAIFCIMTTQLVPKKGKEWTWQPL 202 H T ++ H +++K+Q LAI C+ K K+W W L Sbjct: 1187 HLTLFQAACRGYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKL 1235
>PRIA_ECOLI (P17888) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 732 Score = 28.9 bits (63), Expect = 6.0 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = +2 Query: 56 HCTTYRYQLLSLTMDHHKERKKLQCLAIFCIMTTQLVPKKGKEWTWQPLIYHHIASRL 229 H + QL +L + +KL L L PK+G W WQ L+ H RL Sbjct: 648 HAPLFLQQLRNLILSSPLADEKLWVLG----PVPALAPKRGGRWRWQILLQHPSRVRL 701 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,294,663 Number of Sequences: 219361 Number of extensions: 1362349 Number of successful extensions: 3182 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3182 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)