| Clone Name | rbastl04a09 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC1_MOUSE (Q01705) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| (Motch A) (mT14) (p300) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 29.6 bits (65), Expect = 3.5 Identities = 19/65 (29%), Positives = 31/65 (47%) Frame = -1 Query: 340 LKREAQSLPLGALSTCIPVMLTLKSISNVTNK*CVVLVVILGTSHVDQQSSWYVQIPTSN 161 L +E+Q+LP S+ +P M T + ++ + +S VD S +Q+P Sbjct: 2432 LPQESQALPTSLPSSMVPPMTTTQFLTPPSQH-------SYSSSPVDNTPSHQLQVPEPT 2484 Query: 160 LLTPS 146 LTPS Sbjct: 2485 FLTPS 2489
>MIS_RAT (P49000) Muellerian-inhibiting factor precursor (MIS)| (Anti-Muellerian hormone) (AMH) (Mullerian-inhibiting substance) Length = 553 Score = 29.3 bits (64), Expect = 4.6 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -1 Query: 376 RESLYGSGVIPNLKREAQSLPLGALSTCIPVMLTLKSISNVTNK 245 R YG+ V+ LK +A+ LG L C+P T K + +++ + Sbjct: 492 RNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYTGKLLISLSEE 535
>TPT_SPIOL (P11869) Triose phosphate/phosphate translocator, chloroplast| precursor (cTPT) (p36) (E29) Length = 404 Score = 28.9 bits (63), Expect = 6.0 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -2 Query: 267 RYPMLLTNSVWFWW*FLVPVTSI--SRAAGMFKFPPPIS*LHLCHG 136 +YP L+T S +F W FL + +I + F +P +S +HL G Sbjct: 96 KYPALVTGSFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLFVG 141
>NOTC1_RAT (Q07008) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2531 Score = 28.9 bits (63), Expect = 6.0 Identities = 19/65 (29%), Positives = 31/65 (47%) Frame = -1 Query: 340 LKREAQSLPLGALSTCIPVMLTLKSISNVTNK*CVVLVVILGTSHVDQQSSWYVQIPTSN 161 L +E+Q+LP S+ +P M T + ++ + +S VD S +Q+P Sbjct: 2432 LPQESQALPTSLPSSMVPPMTTTQFLTPPSQH-------SYSSSPVDNTPSHQLQVPEHP 2484 Query: 160 LLTPS 146 LTPS Sbjct: 2485 FLTPS 2489
>TPT_FLATR (P49132) Triose phosphate/phosphate translocator, chloroplast| precursor (cTPT) Length = 407 Score = 28.9 bits (63), Expect = 6.0 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 8/63 (12%) Frame = -2 Query: 267 RYPMLLTNSVWFWW*FLVPVTSI--SRAAGMFKFPPPIS*LHL------CHGSQTSSLGC 112 +YP L+T +F W FL + +I + F +P +S +HL C GS T L Sbjct: 99 KYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLGSWTVGLPK 158 Query: 111 SSP 103 +P Sbjct: 159 RAP 161
>MSMG_STRMU (Q00751) Multiple sugar-binding transport system permease protein| msmG Length = 277 Score = 28.9 bits (63), Expect = 6.0 Identities = 9/29 (31%), Positives = 20/29 (68%) Frame = -2 Query: 255 LLTNSVWFWW*FLVPVTSISRAAGMFKFP 169 L+ N++WFW F++P+ +++ + M+ P Sbjct: 200 LIINALWFWNDFMLPLLILNKDSSMWTLP 228
>SYP_CLOST (Q9L4Q8) Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA| ligase) (ProRS) Length = 481 Score = 28.5 bits (62), Expect = 7.9 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +3 Query: 108 SYSPNWKFGNHDTDGV-RRLEVG 173 +YSP WKF ++ GV RLE+G Sbjct: 332 NYSPGWKFNQYEMKGVPLRLEIG 354 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,007,766 Number of Sequences: 219361 Number of extensions: 1484410 Number of successful extensions: 3224 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3224 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)