| Clone Name | rbastl03h08 |
|---|---|
| Clone Library Name | barley_pub |
>K125_TOBAC (O23826) 125 kDa kinesin-related protein| Length = 1006 Score = 62.8 bits (151), Expect = 2e-10 Identities = 32/51 (62%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = -1 Query: 394 EVPSKGTIESLRAMPIESLMDEFRENHPYES--SKEPKPSVIPRLPLGTLN 248 +VPSK TIESLRAMP+E L++EFREN+ +ES KE KPS+IPR P +N Sbjct: 955 DVPSKVTIESLRAMPMEVLLEEFRENNSFESFQVKEVKPSLIPRSPFSQIN 1005
>K125_ARATH (P82266) Probable 125 kDa kinesin-related protein| Length = 1056 Score = 62.0 bits (149), Expect = 3e-10 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -1 Query: 394 EVPSKGTIESLRAMPIESLMDEFRENHPYES--SKEPKPSVIPRLPLGTL 251 E+P+K TIESLRAMPIE+L++EFREN+ YES +KE KP + R PL L Sbjct: 959 EIPTKATIESLRAMPIETLVEEFRENNSYESFATKETKPQQLTRSPLSQL 1008
>DLL3_HUMAN (Q9NYJ7) Delta-like protein 3 precursor (Drosophila Delta homolog| 3) Length = 618 Score = 30.8 bits (68), Expect = 0.82 Identities = 19/71 (26%), Positives = 28/71 (39%), Gaps = 18/71 (25%) Frame = -1 Query: 172 CPCCARFYGM---LALIQCLLHSC*NVSICCGAAE---------------YSCKKFYDEC 47 C C FYG+ ++ + C C N +C G A+ +C+K D C Sbjct: 298 CTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRC 357 Query: 46 LLHSC*NVSIC 14 L C N +C Sbjct: 358 SLQPCRNGGLC 368
>PALA_SCHPO (Q09807) pH-response regulator protein palA/rim20| Length = 701 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/45 (28%), Positives = 31/45 (68%), Gaps = 6/45 (13%) Frame = +1 Query: 13 NKLIHSSRNAKDTRHKIFYKNIRRLHNKL------IHSSKNAKDT 129 +++I+S +++++ + K FY ++ +LH ++ + +S+NAKDT Sbjct: 447 DEIINSVKSSQNMKEKGFYSDVIKLHEEVSLLKVNVENSQNAKDT 491
>SCD1_SCHPO (P40995) Rho guanine nucleotide exchange factor scd1| Length = 872 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -1 Query: 394 EVPSKGTIESLRAMP-IESLMDEFRENHPYESSKEPKPSVIPRLPLGTLN 248 E+ T +RA+ IE L+ ++ ++ +SS P PS +P GTLN Sbjct: 174 EIYKPSTAPLVRALQTIELLLKKYEVSNTTKSSSTPSPSTDDNVPTGTLN 223
>DOF18_ARATH (Q84JQ8) Dof zinc finger protein DOF1.8 (AtDOF1.8)| Length = 352 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 5/53 (9%) Frame = +2 Query: 143 HPIKPGT-----TRTSKPAAI*CPNQITLHTEKKYYHCFSVECPKWQARDDRR 286 +P P T R K A+ CP +L+T+ YY+ +S+ P++ +D RR Sbjct: 29 NPPSPATPVERKARPEKDQALNCPRCNSLNTKFCYYNNYSLTQPRYFCKDCRR 81
>DLL3_MOUSE (O88516) Delta-like protein 3 precursor (Drosophila Delta homolog| 3) (M-Delta-3) Length = 592 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/71 (25%), Positives = 27/71 (38%), Gaps = 18/71 (25%) Frame = -1 Query: 172 CPCCARFYGM---LALIQCLLHSC*NVSICCGAAE---------------YSCKKFYDEC 47 C C FYG+ ++ + C C N +C G + +C+K D C Sbjct: 296 CACPRGFYGLRCEVSGVTCADGPCFNGGLCVGGEDPDSAYVCHCPPGFQGSNCEKRVDRC 355 Query: 46 LLHSC*NVSIC 14 L C N +C Sbjct: 356 SLQPCQNGGLC 366
>HELS_METJA (Q58524) Putative ski2-type helicase (EC 3.6.1.-) [Contains:| Endonuclease PI-MjaHel (EC 3.1.-.-) (Mja Hel intein) (Mja Pep3 intein)] Length = 1195 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 7 LHNKLIHSSRNAKDTRHKIFYKNIRRLHNKLIHSSKNAKD 126 LH K R +K H I+ K +R++ NKL +K+ K+ Sbjct: 490 LHKKYFLKCRISKGVAHYIYSKKLRKIFNKLNMLTKDNKN 529
>PGBM_HUMAN (P98160) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 4391 Score = 28.5 bits (62), Expect = 4.1 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 315 WFSRNSSIRDSIGIARNDSIVPLLGT 392 W +RN + D++ I+ N SI+ ++GT Sbjct: 3056 WKTRNQELEDNVHISPNGSIITIVGT 3081
>RFCS_PYRAB (Q9V2G4) Replication factor C small subunit (RFC small subunit)| (Clamp loader small subunit) (PabRFC small subunit) [Contains: Pab RFC-1 intein; Pab RFC-2 intein] Length = 1437 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = +2 Query: 260 KWQAR-DDRRLGFLARFIGMVLTE--LIHQGLDWHRSQR 367 KW R DD + G LAR +G +L + L G W S + Sbjct: 924 KWLVRYDDEKAGILARVVGFILGDGHLARNGRIWFNSSK 962
>YFGJ_ECOLI (P76575) Hypothetical protein yfgJ| Length = 83 Score = 27.7 bits (60), Expect = 6.9 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -1 Query: 226 LFCVQCNLIRTSNRCWL*CPCCARFYGMLALI-QCLLHSC*NVSICCGAAEYSCK 65 L C QC + + C C F M AL C H V CGA +Y C+ Sbjct: 15 LHCPQCQHVLDQDNGHARCRSCGEFIEMKALCPDC--HQPLQVLKACGAVDYFCQ 67
>COBS_LEPIN (Q8EYK8) Cobalamin synthase (EC 2.-.-.-)| Length = 265 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -2 Query: 153 FMGC*PSSSVFCILARMYQFVVEPPNILVKNFMTSVFCIPARMY 22 F GC P+ + +YQF + PN+L+ F++S+F R Y Sbjct: 193 FFGCFPA------VYFLYQFQNQIPNVLLGFFLSSIFVFYFRNY 230
>COBS_LEPIC (Q72M34) Cobalamin synthase (EC 2.-.-.-)| Length = 265 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -2 Query: 153 FMGC*PSSSVFCILARMYQFVVEPPNILVKNFMTSVFCIPARMY 22 F GC P+ + +YQF + PN+L+ F++S+F R Y Sbjct: 193 FFGCFPA------VYFLYQFQNQIPNVLLGFFLSSIFVFYFRNY 230
>PHF2_HUMAN (O75151) PHD finger protein 2 (GRC5)| Length = 1101 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 364 LRAMPIESLMDEFRENHPYESSKEPKPSVIPRLP 263 + A P +SL+++ + ++ K PKPS IP+ P Sbjct: 476 IEATPPQSLLEKVSKKKTPKTVKMPKPSKIPKPP 509
>PMIP_HUMAN (Q99797) Mitochondrial intermediate peptidase, mitochondrial| precursor (EC 3.4.24.59) (MIP) Length = 713 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 3/73 (4%) Frame = +2 Query: 125 TLDE---G*HPIKPGTTRTSKPAAI*CPNQITLHTEKKYYHCFSVECPKWQARDDRRLGF 295 TLD+ G HP++ TT I T++K+Y V WQ R +G+ Sbjct: 581 TLDQIYHGKHPLRNSTT------------DILKETQEKFYGLPYVPNTAWQLRFSHLVGY 628 Query: 296 LARFIGMVLTELI 334 AR+ +++ + Sbjct: 629 GARYYSYLMSRAV 641
>CRUM1_MOUSE (Q8VHS2) Crumbs homolog 1 precursor| Length = 1405 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 103 VSICC-GAAEYSCKKFYDECLLHSC*NVSIC 14 V IC G C++ DECLLH C N C Sbjct: 381 VCICQPGFTGIHCEEDVDECLLHPCLNGGTC 411 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,999,664 Number of Sequences: 219361 Number of extensions: 1168789 Number of successful extensions: 3069 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 2939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3063 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)