| Clone Name | rbastl03f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PLSX_PROMM (Q7V4F7) Fatty acid/phospholipid synthesis protein plsX | 30 | 3.5 | 2 | VG12_SHV21 (P24915) Hypothetical gene 12 protein | 29 | 4.5 | 3 | NIN_HUMAN (Q8N4C6) Ninein (hNinein) | 28 | 7.7 | 4 | MYX2_CROVC (P12029) Myotoxin-2 (Myotoxin II) | 28 | 7.7 | 5 | KI13A_HUMAN (Q9H1H9) Kinesin-like protein KIF13A (Kinesin-like p... | 28 | 7.7 |
|---|
>PLSX_PROMM (Q7V4F7) Fatty acid/phospholipid synthesis protein plsX| Length = 448 Score = 29.6 bits (65), Expect = 3.5 Identities = 17/54 (31%), Positives = 32/54 (59%) Frame = +2 Query: 143 KPQS*HRKHVWKRKSAQV*HLSW*ACNSCSYSGNVSAILSIRSSGKICAWRGAV 304 +P++ R +W R++A V L A NS S +GNV+ + + S+G + + G++ Sbjct: 20 RPRAIRRLVIWYRRNAAVTSLVGSATNSASAAGNVAGTV-VSSAGSVVSNAGSM 72
>VG12_SHV21 (P24915) Hypothetical gene 12 protein| Length = 169 Score = 29.3 bits (64), Expect = 4.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 131 ILFVVCFRYSACSLCSCMK*WTTMYYWDSPLLVDEKYHSFY 9 I+ VC C LC + T+ W S +L E Y++FY Sbjct: 76 IVLCVCVSTLLCILCILLDICLTIRLWQSSVLCYEVYNTFY 116
>NIN_HUMAN (Q8N4C6) Ninein (hNinein)| Length = 2090 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 67 VHHFIHEHKEQAEYLKQTTNKIEIMKAPKL 156 VHH I E K++ +YL+ T +E +KA ++ Sbjct: 1380 VHHVIEECKQENQYLEGNTQLLEKVKAHEI 1409
>MYX2_CROVC (P12029) Myotoxin-2 (Myotoxin II)| Length = 43 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 340 HKTSGSFIDSEIYCTPPSADFAR 272 HK G E CTPPS+DF + Sbjct: 5 HKKGGHCFPKEKICTPPSSDFGK 27
>KI13A_HUMAN (Q9H1H9) Kinesin-like protein KIF13A (Kinesin-like protein RBKIN)| Length = 1805 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +1 Query: 79 IHEHKEQAEYLKQTTNKIEIMKAPKLT*KTCLEKKICTSLT 201 I E +E+ E L++ ++ E MKAP+L K +K+ LT Sbjct: 367 IRELREEVEKLREQLSQAEAMKAPELKEKLEESEKLIKELT 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,284,200 Number of Sequences: 219361 Number of extensions: 1012050 Number of successful extensions: 3138 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3137 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)