| Clone Name | rbastl03e10 |
|---|---|
| Clone Library Name | barley_pub |
>OREX_RAT (O55232) Orexin precursor (Hypocretin) (Hcrt) [Contains: Orexin-A| (Hypocretin-1) (Hcrt1); Orexin-B (Hypocretin-2) (Hcrt2)] Length = 130 Score = 30.8 bits (68), Expect = 1.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 298 RQSPIAVDPGPCPGERCPAAFASLM 372 R++ ++P PCPG RCP A A+ + Sbjct: 98 RRAGAELEPYPCPGRRCPTATATAL 122
>LAMB3_MOUSE (Q61087) Laminin beta-3 chain precursor (Laminin 5 beta 3) (Kalinin| B1 chain) Length = 1168 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 298 RQSPIAVDPGPCPGERCPAAFASLMQRHHPGSLKR 402 R A PG CPGE CP + H G+L R Sbjct: 786 RSRQTACTPGDCPGELCPQDNGTACGSHCRGALPR 820
>RPOA_PRRSB (Q8B912) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP Length = 3963 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 423 FGIVDPITL*GSWMVSLHQRCKSCWATLSRT 331 FGIV L G++++S RCK CW + RT Sbjct: 1375 FGIVADCILAGAYVLS-QGRCKKCWGSCVRT 1404
>PEPT_HAEIN (P45172) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 412 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 4/31 (12%) Frame = -3 Query: 418 YRGSDYALGI----LDGVFASEMQKLLGNAL 338 YRG D ALGI + V+ S MQKL+G L Sbjct: 104 YRGGDIALGIGEEFISPVYYSFMQKLVGQTL 134
>PEPT_HAEI8 (Q4QK58) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 412 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 4/31 (12%) Frame = -3 Query: 418 YRGSDYALGI----LDGVFASEMQKLLGNAL 338 YRG D ALGI + V+ S MQKL+G L Sbjct: 104 YRGGDIALGIGEEFISPVYYSFMQKLVGQTL 134
>PUR6_CANAL (Q92210) Phosphoribosylaminoimidazole carboxylase (EC 4.1.1.21)| (AIR carboxylase) (AIRC) Length = 568 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 17 IYTPFKIPNTLFGKHILLATNQLHNFP 97 +Y P +IP+TL K +LA N + +FP Sbjct: 222 VYAPARIPDTLGQKASILAKNAVKSFP 248
>VIF_FIVPE (P16089) Virion infectivity factor| Length = 251 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/64 (23%), Positives = 31/64 (48%) Frame = +3 Query: 243 EC*TVLLLPRRPQQRIERASITDCGGSRSLSWRALPSSFCISDAKTPSRIPKA*SDPRYQ 422 +C ++ L P + ++R ++ CG WR + +S +TP+ + S P + Sbjct: 186 DCWNLMCLRNSPPKTLQRLAMLACGVPAK-KWRGCCNQRFVSPYRTPADLEVIQSKPSWN 244 Query: 423 ILFS 434 +L+S Sbjct: 245 LLWS 248 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,192,484 Number of Sequences: 219361 Number of extensions: 1482633 Number of successful extensions: 3904 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3903 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)