| Clone Name | rbastl03e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPA12_RAT (Q8R4Z1) Serpin A12 precursor (Visceral adipose-specif... | 35 | 0.084 | 2 | YCF80_GUITH (O78449) Hypothetical 33.2 kDa protein ycf80 | 30 | 3.5 | 3 | CRY2_VIBCH (Q9KS67) Cryptochrome-like protein cry2 | 30 | 4.6 | 4 | SPA12_MOUSE (Q7TMF5) Serpin A12 precursor (Visceral adipose-spec... | 29 | 6.0 | 5 | FLHC_YEREN (O86047) Flagellar transcriptional activator flhC | 29 | 6.0 |
|---|
>SPA12_RAT (Q8R4Z1) Serpin A12 precursor (Visceral adipose-specific serpin)| (Visceral adipose tissue-derived serine protease inhibitor) (Vaspin) Length = 411 Score = 35.4 bits (80), Expect = 0.084 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 13/108 (12%) Frame = +1 Query: 142 EITCTVL*LQGRGNLTATMTMPN---LHLHTACAQT*VKS------CKTMHD*SRP---- 282 +++CT+L + RGN+TAT +P+ L L Q + + K + D P Sbjct: 254 QLSCTILEMPYRGNITATFVLPDSGKLRLLEQGLQADIFAKWKSLLSKRVVDVWVPRLHI 313 Query: 283 TAFSGNQQ*ISTLPLNKLMESHLPLERFSRRPLLISGDLVHEALLNKN 426 +A ++ +S L ++K+ E H L R S L G+ VH+A L N Sbjct: 314 SATYNMKKVLSRLGISKIFEEHGDLTRISSHRSLKVGEAVHKAELRMN 361
>YCF80_GUITH (O78449) Hypothetical 33.2 kDa protein ycf80| Length = 282 Score = 30.0 bits (66), Expect = 3.5 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 51 EILQTFPTKKNSRISIRSFLKYNSGCFKLIGDYMYSFIITG-SWELDSN 194 EI NSR+S KY+ FK I ++YS +T W L SN Sbjct: 216 EIKNILNVNSNSRVSFHPKQKYDKNWFKGIPIFIYSPTVTNLDWTLKSN 264
>CRY2_VIBCH (Q9KS67) Cryptochrome-like protein cry2| Length = 504 Score = 29.6 bits (65), Expect = 4.6 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = -3 Query: 310 SIAGFQRMLWAYSNRASF-CNF*LRSVHRRCE----DVNLAWSSLLSSSHD 173 S+AGF+R L A S+R + C+F ++ CE VN A+ SLL S D Sbjct: 253 SVAGFRRSLIALSSRLHWHCHF-IQKFESECEMEFRCVNRAYDSLLQQSSD 302
>SPA12_MOUSE (Q7TMF5) Serpin A12 precursor (Visceral adipose-specific serpin)| (Visceral adipose tissue-derived serine protease inhibitor) (Vaspin) Length = 413 Score = 29.3 bits (64), Expect = 6.0 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 13/105 (12%) Frame = +1 Query: 142 EITCTVL*LQGRGNLTATMTMPN---LHLHTACAQT*VKS------CKTMHD*SRP---- 282 +++CT+L + RGN+TAT +P+ L L Q + + K + D P Sbjct: 254 QLSCTILEIPYRGNITATFVLPDNGKLKLLEQGLQADIFAKWKSLLSKRVVDVWVPKLRI 313 Query: 283 TAFSGNQQ*ISTLPLNKLMESHLPLERFSRRPLLISGDLVHEALL 417 ++ ++ +S L ++K+ E + L R S L G+ VH+A L Sbjct: 314 SSTYNMKKVLSRLGISKIFEENGDLTRISSHRSLKVGEAVHKAEL 358
>FLHC_YEREN (O86047) Flagellar transcriptional activator flhC| Length = 193 Score = 29.3 bits (64), Expect = 6.0 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = -1 Query: 375 PPTKSFKRQMTLHEFVQRQCTDLLLVSRECCGPTLIVHRFATFNSGLCT 229 PP + R TL FV L L CCG T I H NS +C+ Sbjct: 113 PPLLALTRAWTLVRFVDSGM--LQLSGCNCCGGTFITHAHQPRNSFVCS 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,278,161 Number of Sequences: 219361 Number of extensions: 1355456 Number of successful extensions: 2705 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2704 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)