| Clone Name | rbastl03a09 |
|---|---|
| Clone Library Name | barley_pub |
>HSP90_EIMTE (O44001) Heat shock protein 90| Length = 713 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 53 IQSNRQTDGHKSLLCCTYKALEV*NSSMNNDKSKELQAD 169 +Q ++ D HK L CCT + LE+ S K +EL+A+ Sbjct: 514 VQQLKEFDNHK-LRCCTKEGLEIDESEEEKKKFEELKAE 551
>KR510_HUMAN (Q6L8G5) Keratin-associated protein 5-10 (Keratin-associated| protein 5.10) (Ultrahigh sulfur keratin-associated protein 5.10) Length = 202 Score = 29.3 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 155 PSTCRCSCCCFRLPVLCRCSRVEICAHLSVCC 60 P C+ SCC +PV C+ S + C S CC Sbjct: 165 PCCCQSSCC---VPVCCQSSCCKPCCCQSSCC 193
>EX7L_XANAC (Q8PJW7) Probable exodeoxyribonuclease VII large subunit (EC| 3.1.11.6) (Exonuclease VII large subunit) Length = 445 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +1 Query: 16 RITRSATKL*THNPKQQTDRWAQISTLLHLQSTGSLKQQHEQRQVEGITGRL 171 R+ R +L +HNP++ Q LH Q+ + QH+Q Q+ I L Sbjct: 339 RVQRGQAQLQSHNPQRHLAGLQQRLRALHPQAAMQRRLQHDQLQLRRIARSL 390
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 155 PSTCRCSCCCFRLPVLCRCSRVEICAHLSVCC 60 P C+ SCC +PV C+ S + C S CC Sbjct: 140 PCCCQSSCC---VPVCCQSSCCKPCCCQSNCC 168
>VWF_HUMAN (P04275) Von Willebrand factor precursor (vWF) [Contains: Von| Willebrand antigen II] Length = 2813 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -1 Query: 167 LPVIPS----TCRCSCCCFRLPVLCRCSRVEIC 81 +PV PS +C+ S CC CRC R+E C Sbjct: 2554 VPVCPSGFQLSCKTSACC----PSCRCERMEAC 2582
>EPL1_ASPFU (Q4WDF1) Enhancer of polycomb-like protein 1| Length = 582 Score = 28.5 bits (62), Expect = 4.1 Identities = 18/74 (24%), Positives = 34/74 (45%) Frame = +1 Query: 82 QISTLLHLQSTGSLKQQHEQRQVEGITGRLTEKNYGFFVLDEKP*KRNSEVAASERPTRK 261 Q S + ++ ++K E + +T + F L E+P K+ +E A++RPT Sbjct: 283 QRSEVKEMKRKLNIKDDDEDLINQKVTSIPARLPHAFANLPEQPKKKPAEAPAAQRPTAP 342 Query: 262 *SQYPNQPPLRRGD 303 + P +P + D Sbjct: 343 QIRMPQKPGTQAAD 356
>KR415_HUMAN (Q9BYQ5) Keratin-associated protein 4-15 (Keratin-associated| protein 4.15) (Ultrahigh sulfur keratin-associated protein 4.15) (Fragment) Length = 193 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -1 Query: 155 PSTCRCSC----CCFRLPVLCRCSRVEICAHLSVCC 60 P+ CR SC CC + RC R + C SVCC Sbjct: 90 PTCCRPSCSISSCCRPSCCVSRCCRSQCCQ--SVCC 123
>SPA4L_HUMAN (Q8TC36) Sperm-associated antigen 4-like protein (Testis and| spermatogenesis-related gene 4 protein) Length = 379 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -1 Query: 161 VIPSTCRCSCCCFRLPVLCRCSRVEICAHLSVCCFGLWVYN 39 V+ +TCRC C +L +E L +C FG W+++ Sbjct: 87 VLFNTCRCKLLCQKL--------MEKTGILLLCAFGFWMFS 119
>UXAC_STRA5 (Q8E0M9) Uronate isomerase (EC 5.3.1.12) (Glucuronate isomerase)| (Uronic isomerase) Length = 466 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -3 Query: 219 FLGFFVEYKKTVIFFSQSACNSFDLSLFMLLFQTSSAL*VQQSRDLCPSVC 67 F F ++ + +F+Q+ C + D+S ++F+ + L + DL VC Sbjct: 211 FSTFIAAMEERIAYFAQNGCRASDISFTEIVFEQTDEL---ELNDLFNKVC 258
>UXAC_STRA3 (Q8E6A3) Uronate isomerase (EC 5.3.1.12) (Glucuronate isomerase)| (Uronic isomerase) Length = 466 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -3 Query: 219 FLGFFVEYKKTVIFFSQSACNSFDLSLFMLLFQTSSAL*VQQSRDLCPSVC 67 F F ++ + +F+Q+ C + D+S ++F+ + L + DL VC Sbjct: 211 FSTFIAAMEERIAYFAQNGCRASDISFTEIVFEQTDEL---ELNDLFNKVC 258
>UPPS_MYCPF (Q93AU4) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 296 Score = 27.7 bits (60), Expect = 6.9 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +2 Query: 173 LKKITVFLYSTKNPKKETQR*QHPRGRHENEV-NTRTNRPCVGVTASCFGKCFLAWNEKV 349 +K +TV+ +ST+N K+ T+ + G + V R N +GV G W+ + Sbjct: 112 IKHLTVYAFSTENWKRSTEEVRFLMGFNREVVRRRRENLNDMGVRMRWVGSRPRMWSSVI 171 Query: 350 AEF 358 EF Sbjct: 172 KEF 174
>KRA47_HUMAN (Q9BYR0) Keratin-associated protein 4-7 (Keratin-associated protein| 4.7) (Ultrahigh sulfur keratin-associated protein 4.7) Length = 210 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -1 Query: 158 IPSTCRCSCCCFRLPVLCRCSRVEICAHLSVCC 60 I S CR SCC + RC R + C SVCC Sbjct: 116 ISSCCRPSCC------VSRCCRPQCCQ--SVCC 140
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 146 CRCSCCCFRLPVLCRCSRVEICAHLSVCC 60 C C CC +LC C + C S CC Sbjct: 620 CCCRVCCRACCLLCGCPK---CCRCSKCC 645
>K0182_HUMAN (Q14687) Protein KIAA0182 (Fragment)| Length = 1157 Score = 27.3 bits (59), Expect = 9.1 Identities = 24/81 (29%), Positives = 31/81 (38%) Frame = +2 Query: 47 PTIQSNRQTDGHKSLLCCTYKALEV*NSSMNNDKSKELQAD*LKKITVFLYSTKNPKKET 226 PTIQS RQT + L Y E+ NS +K K L L I+ K E Sbjct: 770 PTIQSKRQTPSPRLALSTRYSPDEMNNSPNFEEKKKFLTIFNLTHISAEKRKDKERLVEM 829 Query: 227 QR*QHPRGRHENEVNTRTNRP 289 R + ++ TN P Sbjct: 830 LRAMKQKALSAAVADSLTNSP 850
>SFRS8_HUMAN (Q12872) Splicing factor, arginine/serine-rich 8 (Suppressor of| white apricot protein homolog) Length = 951 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 146 KSKELQAD*LKKITVFLYSTKNPKKETQ 229 K K+LQA+ +K +FL + KNP E + Sbjct: 675 KEKQLQAERKRKAALFLQTLKNPLPEAE 702
>NPT2B_PONPY (Q5REV9) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 689 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -1 Query: 146 CRCSCCCFRLPVLCRCSRVEICAHLSVCC 60 C C CC +LC C + C S CC Sbjct: 619 CCCRVCCRACCLLCGCPK---CCRCSKCC 644
>CNTN2_CHICK (P28685) Contactin-2 precursor (Axonin-1)| Length = 1036 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +1 Query: 4 LKWRRITRSATKL*THNPKQQTDRWAQISTLLHLQSTGSLKQQHEQRQVEGITGRLT 174 +KWR++ S QT +W LLH+Q+ + + + E I GR T Sbjct: 266 IKWRKLDGS-----------QTSKWLSSEPLLHIQNVDFEDEGTYECEAENIKGRDT 311
>PLS4_MOUSE (P58196) Phospholipid scramblase 4 (PL scramblase 4)| (Ca(2+)-dependent phospholipid scramblase 4) Length = 326 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 143 RCSCCCFRLPVLCRCSRVEI 84 RC+CCCF C C+R E+ Sbjct: 190 RCTCCCF----CCPCARQEL 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,028,210 Number of Sequences: 219361 Number of extensions: 1090288 Number of successful extensions: 2936 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2930 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)