| Clone Name | rbastl02g06 |
|---|---|
| Clone Library Name | barley_pub |
>PHYA3_AVESA (P06593) Phytochrome A type 3 (AP3)| Length = 1128 Score = 35.4 bits (80), Expect = 0.056 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 425 EAGMSIFILTAELACAPTAMRQ 360 EAG+S FI+TAELA APTAM Q Sbjct: 1107 EAGVSTFIITAELASAPTAMGQ 1128
>PHYA_SORBI (P93526) Phytochrome a| Length = 1131 Score = 35.0 bits (79), Expect = 0.074 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 425 EAGMSIFILTAELACAPTAMRQ 360 EAGMS FILTAELA AP+A+ Q Sbjct: 1110 EAGMSTFILTAELAAAPSAVGQ 1131
>PHYA4_AVESA (P06594) Phytochrome A type 4 (AP4)| Length = 1128 Score = 34.7 bits (78), Expect = 0.096 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 425 EAGMSIFILTAELACAPTAMRQ 360 EAG+S FILTAELA APTA+ Q Sbjct: 1107 EAGVSTFILTAELASAPTAIGQ 1128
>PHYA1_MAIZE (P19862) Phytochrome A| Length = 1131 Score = 33.9 bits (76), Expect = 0.16 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -2 Query: 425 EAGMSIFILTAELACAPTAM 366 EAGMS FILTAELA AP+A+ Sbjct: 1110 EAGMSTFILTAELAAAPSAV 1129
>VGLX_PRVRI (P07562) Secreted glycoprotein GX| Length = 498 Score = 32.7 bits (73), Expect = 0.37 Identities = 26/78 (33%), Positives = 34/78 (43%), Gaps = 10/78 (12%) Frame = +3 Query: 99 HSRTDEKNTTTHHKYVTKPCHTTFLYPR-LITDPTGQP-LLLPFC--------IHLTLYH 248 H R D++ HH+ +P TF+ P + PTG P LLL F +HLT Sbjct: 356 HHRADDRGPQRHHRLPPEP---TFVSPSDIFVTPTGSPALLLGFLGSALASRPLHLTAGE 412 Query: 249 SLLQPRRIFPASHHRRSL 302 + R S H RSL Sbjct: 413 TAQHVREAQQKSRHIRSL 430
>GIDA_BURPS (Q63PG8) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 657 Score = 31.2 bits (69), Expect = 1.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +3 Query: 135 HKYVTKPCHTTFLYPRLITD----PTGQPLLLPFCIHLTLYHSL 254 H++ +K H FL P +T P G LPF + L L HS+ Sbjct: 286 HRFASKDSHQIFLEPEGLTTNEFYPNGISTSLPFDVQLALVHSM 329
>GIDA_BURMA (Q62FS8) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 657 Score = 31.2 bits (69), Expect = 1.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +3 Query: 135 HKYVTKPCHTTFLYPRLITD----PTGQPLLLPFCIHLTLYHSL 254 H++ +K H FL P +T P G LPF + L L HS+ Sbjct: 286 HRFASKDSHQIFLEPEGLTTNEFYPNGISTSLPFDVQLALVHSM 329
>GIDA_RALSO (Q8XU65) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gidA (Glucose-inhibited division protein A) Length = 647 Score = 31.2 bits (69), Expect = 1.1 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +3 Query: 135 HKYVTKPCHTTFLYPRLITD----PTGQPLLLPFCIHLTLYHSL 254 H++ +K H FL P +T P G LPF + L L HS+ Sbjct: 286 HRFASKDSHQIFLEPEGLTTNEFYPNGVSTSLPFDVQLDLIHSM 329
>EFTU_TOBAC (P68158) Elongation factor Tu, chloroplast precursor (EF-Tu)| Length = 478 Score = 30.8 bits (68), Expect = 1.4 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 194 SYRPTFASSFLHSLNTLPQPAATASHLPRKSSPSFAHGSFEMK 322 S+ P ++ FLHS T P++TA+H R+ + A G FE K Sbjct: 39 SFTPNCSTLFLHSPAT---PSSTATHRHRRFTVRAARGKFERK 78
>EFTUA_NICSY (Q40450) Elongation factor TuA, chloroplast precursor (EF-TuA)| Length = 478 Score = 30.8 bits (68), Expect = 1.4 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 194 SYRPTFASSFLHSLNTLPQPAATASHLPRKSSPSFAHGSFEMK 322 S+ P ++ FLHS T P++TA+H R+ + A G FE K Sbjct: 39 SFTPNCSTLFLHSPAT---PSSTATHRHRRFTVRAARGKFERK 78
>ELMO3_MOUSE (Q8BYZ7) Engulfment and cell motility protein 3| Length = 607 Score = 28.5 bits (62), Expect = 6.9 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 51 KHLRRSIKLEPYTYILHSRTDEKNTTTHHKYVTKPCHTTFLYPRLIT--DPTGQ 206 K+LR+ I Y I+HS T + HH YV + L PR+ T DP Q Sbjct: 144 KNLRQFI----YKNIIHSATPMGDEMAHHLYVLQALTLGLLEPRMRTPLDPYSQ 193
>VPS15_PICPA (Q9UVG6) Putative serine/threonine-protein kinase VPS15 (EC| 2.7.11.1) (Vacuolar protein sorting protein 15) Length = 1339 Score = 28.5 bits (62), Expect = 6.9 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 3/64 (4%) Frame = +3 Query: 54 HLRRSIKLEPYT---YILHSRTDEKNTTTHHKYVTKPCHTTFLYPRLITDPTGQPLLLPF 224 H+ +S K PY IL+ TTH Y K C + +++D LP+ Sbjct: 376 HIPQSSKT-PYDSALIILNILLHSMRNTTHSSYRIKSCDLILMISEMLSDEQKLDRCLPY 434 Query: 225 CIHL 236 +HL Sbjct: 435 LVHL 438
>COQ9_YEAST (Q05779) Ubiquinone biosynthesis protein COQ9, mitochondrial| precursor Length = 260 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 218 SFLHSLNTLPQPAATASHLPRKSSPSFAHGSFEMKHLM 331 S + SLN L P++ S + +SPSF H S + L+ Sbjct: 62 SIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELI 99
>SLS1_YEAST (P42900) Sigma-like sequence protein 1, mitochondrial precursor| (Protein SLS1) Length = 643 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 90 YILHSRTDEKNTTTHHKYVTKPCHTTFLYP 179 ++L++ NTT HH + P T LYP Sbjct: 294 FLLNAVASNPNTTQHHHTIASPALKTELYP 323
>PHYA_ORYSA (P10931) Phytochrome A| Length = 1128 Score = 28.1 bits (61), Expect = 9.0 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 425 EAGMSIFILTAELACAP 375 EAGMS FIL+ ELA AP Sbjct: 1110 EAGMSTFILSVELASAP 1126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,678,265 Number of Sequences: 219361 Number of extensions: 1094362 Number of successful extensions: 2651 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2650 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)