| Clone Name | rbastl02f10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CCA_BORPE (Q7U358) CCA-adding enzyme (EC 2.7.7.25) (EC 2.7.7.21)... | 29 | 4.9 | 2 | CCA_BORBR (Q7U391) CCA-adding enzyme (EC 2.7.7.25) (EC 2.7.7.21)... | 29 | 4.9 | 3 | PSTA_DICDI (P11976) Prestalk protein precursor | 29 | 4.9 | 4 | UVRC_LACLA (Q9CH98) UvrABC system protein C (Protein uvrC) (Exci... | 29 | 6.4 | 5 | PRIM_STRCO (Q9S1N4) DNA primase (EC 2.7.7.-) | 29 | 6.4 |
|---|
>CCA_BORPE (Q7U358) CCA-adding enzyme (EC 2.7.7.25) (EC 2.7.7.21) (tRNA| nucleotidyltransferase) (tRNA adenylyl-/cytidylyl- transferase) (tRNA CCA-pyrophosphorylase) (tRNA-NT) Length = 364 Score = 29.3 bits (64), Expect = 4.9 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 300 GRSALICRHSSENSNLGSITRFVARAANTTELHTVVVACSEASSPP 437 GR AL+CRH+ E LG R + L + V AS+ P Sbjct: 241 GRYALLCRHTPERDALGRRLRAPVECMDQARLLPLAVDALAASATP 286
>CCA_BORBR (Q7U391) CCA-adding enzyme (EC 2.7.7.25) (EC 2.7.7.21) (tRNA| nucleotidyltransferase) (tRNA adenylyl-/cytidylyl- transferase) (tRNA CCA-pyrophosphorylase) (tRNA-NT) Length = 364 Score = 29.3 bits (64), Expect = 4.9 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 Query: 300 GRSALICRHSSENSNLGSITRFVARAANTTELHTVVVACSEASSPP 437 GR AL+CRH+ E LG R + L + V AS+ P Sbjct: 241 GRYALLCRHTPERDALGRRLRAPVECMDQARLLPLAVDALAASATP 286
>PSTA_DICDI (P11976) Prestalk protein precursor| Length = 1046 Score = 29.3 bits (64), Expect = 4.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 97 NSCSSCSKPIPCDGSNAC 44 NS SC PI CD +NAC Sbjct: 255 NSTGSCHTPITCDDNNAC 272
>UVRC_LACLA (Q9CH98) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 668 Score = 28.9 bits (63), Expect = 6.4 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = -2 Query: 359 GYASQIAVFRRMATDQGGSSPI----ENDSHQPYEVLWEWPNASIPLTEFGRR*YYLT 198 G A Q+ + +++ + G S P+ +ND HQ E+L+ P +PL+ + + LT Sbjct: 511 GGAGQVNITKQVLKELGLSIPVAGMQKNDKHQTSELLFGDPLDVVPLSRQSQEFFLLT 568
>PRIM_STRCO (Q9S1N4) DNA primase (EC 2.7.7.-)| Length = 641 Score = 28.9 bits (63), Expect = 6.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 416 ASHNYSVEFSGVGGSSDEPGYASQIAVFRRMATDQGGSSP 297 A H +V+ +G+ G D +IA R A D+GG P Sbjct: 412 AQHEVAVQLAGMLGILDTQFVVKRIAQLARWARDRGGKGP 451 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,697,411 Number of Sequences: 219361 Number of extensions: 1292587 Number of successful extensions: 3382 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3380 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)