| Clone Name | rbastl02e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GOP1_CAEEL (P46578) Hypothetical protein gop-1 | 30 | 3.0 | 2 | LINES_DROME (Q9V4Z9) Protein Lines | 29 | 5.1 | 3 | SH2D3_MOUSE (Q9QZS8) SH2 domain-containing protein 3C (SH2 domai... | 28 | 6.7 | 4 | PNO_EUGGR (Q94IN5) Pyruvate dehydrogenase [NADP+], mitochondrial... | 28 | 8.8 | 5 | CAC1E_RABIT (Q02343) Voltage-dependent R-type calcium channel al... | 28 | 8.8 |
|---|
>GOP1_CAEEL (P46578) Hypothetical protein gop-1| Length = 892 Score = 29.6 bits (65), Expect = 3.0 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 300 DQRLIHGEVQAPP*GVEARQPVLTSSYVSDVHM 202 D +++H V+ P ++ R PVLT+ ++ D H+ Sbjct: 755 DSKVLHVVVEGQPSRIKKRHPVLTAKFIFDDHI 787
>LINES_DROME (Q9V4Z9) Protein Lines| Length = 858 Score = 28.9 bits (63), Expect = 5.1 Identities = 22/102 (21%), Positives = 42/102 (41%), Gaps = 5/102 (4%) Frame = +2 Query: 119 EVPSHIQYGKKVLPPSRN-----IKIFFKRNLYICTSET*EEVSTGCLASTPHGGACTSP 283 ++ I+ G K LPP + + N ++C+S + + ST + T+P Sbjct: 40 KIEQQIKVGSKALPPQPPHPPDILDLDANSNSHLCSSLSSSSSHSLSTPSTANNSPTTTP 99 Query: 284 CMSR*SASAWQADSMAPWR*NSVVSSAHRARHHSC*TCGGLP 409 C SR ++ A ++ P ++ + S + H LP Sbjct: 100 CSSRAASYAQLLHNILPQNGDTDLHSQPESAHDEVDRAAKLP 141
>SH2D3_MOUSE (Q9QZS8) SH2 domain-containing protein 3C (SH2 domain-containing| Eph receptor-binding protein 1) (Cas/HEF1-associated signal transducer) Length = 854 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 401 LRKSNTSDDELDELSSPLSFISKAPSNP 318 +R S D++ +L SPLS IS++PS+P Sbjct: 385 IRNCALSMDQIPDLHSPLSPISESPSSP 412
>PNO_EUGGR (Q94IN5) Pyruvate dehydrogenase [NADP+], mitochondrial precursor (EC| 1.2.1.51) (EC 1.16.1.5) (Pyruvate:NADP+ oxidoreductase) (EgPNOmt) (Aquacobalamin reductase [NADPH]) Length = 1803 Score = 28.1 bits (61), Expect = 8.8 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = -3 Query: 240 PVLTSSYVSD-VHMYKFRLKNIFILRDGGSTFLPYCMCDGTSKLVVKIILVHSEQFFFQL 64 P T S V + + Y K++ + + GS LP+CM G V IL F++ Sbjct: 1468 PENTRSVVEEFLQYYGLNPKDVITIENKGSRELPHCMAVGDLFTKVLDILGKPNNRFYKT 1527 Query: 63 VSY 55 +SY Sbjct: 1528 LSY 1530
>CAC1E_RABIT (Q02343) Voltage-dependent R-type calcium channel alpha-1E subunit| (Voltage-gated calcium channel alpha subunit Cav2.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 6) (Brain calcium channel II) (BII) Length = 2259 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 337 PRRHRIRLPS*SRSAAHTRRGTGS 266 P RH R PS RS + +R+GTGS Sbjct: 2061 PERHPSRSPSEGRSQSPSRQGTGS 2084 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,665,690 Number of Sequences: 219361 Number of extensions: 1189666 Number of successful extensions: 2452 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2452 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)