| Clone Name | rbastl02e09 |
|---|---|
| Clone Library Name | barley_pub |
>NIFK_METBA (P51754) Nitrogenase molybdenum-iron protein beta chain (EC| 1.18.6.1) (Nitrogenase component I) (Dinitrogenase) Length = 456 Score = 29.3 bits (64), Expect = 3.7 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 7/32 (21%) Frame = -3 Query: 306 CMPASHSSQSCISIL-------YRKTDKATTT 232 CMP SH SQ C+S L YR+ ATT+ Sbjct: 38 CMPHSHGSQGCLSYLRMCLSRHYREAALATTS 69
>GON1_ORYLA (Q9DGC8) Progonadoliberin-1 precursor (Progonadoliberin I)| (Medaka-type gonadotropin-releasing hormone) (mdGnRH) (mfGnRH) [Contains: Gonadoliberin-1 (Gonadoliberin I) (Luteinizing hormone-releasing hormone I) (LH-RH I) (Gonadotropin-releasing Length = 91 Score = 28.5 bits (62), Expect = 6.4 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -3 Query: 396 SKNGSRQNSSIKYF*EQIENEAIILGYIIQCMPASHSSQSCISILYR 256 S G R+ +KYF +EN+ +L C SH +S ++ +YR Sbjct: 29 SPGGKRE---LKYFPNTLENQIRLLNSNTPCSDLSHLEESSLAKIYR 72
>SYI_RICTY (Q68WC2) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1086 Score = 28.1 bits (61), Expect = 8.3 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 6/49 (12%) Frame = -2 Query: 316 YHTMYACFPLFTILYKYFVPQNRQSNYHG------TYVSCTILLVSNHV 188 Y+T+Y+C TI VP ++ Y G T ++C +LL HV Sbjct: 773 YNTLYSCLETMTIAMSALVPMISEAIYQGLHNTAITQLNC-LLLEGKHV 820
>LIPA_BACTN (Q8A029) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 282 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 22 LTSIIQYLQPNHRHYTTPGY 81 + +I QYLQP HRHY Y Sbjct: 225 ILTIGQYLQPTHRHYPVAEY 244
>RS10_DICDI (O77082) 40S ribosomal protein S10| Length = 153 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +2 Query: 71 HPAIARTEDADVAWCFSETATRKLLTRRFPWEFY 172 HP I + DV +RK +T F W++Y Sbjct: 32 HPQIETVSNLDVLQILRSFKSRKFVTETFNWQYY 65
>ADR1_YEAST (P07248) Regulatory protein ADR1| Length = 1323 Score = 28.1 bits (61), Expect = 8.3 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -3 Query: 237 TTERMYPAQFCSFPTMCDSRNR*NSQGNLLVNNFRVAVSEKHHATSAS 94 T R+YP +F FP + ++ N +LV ++ +E H+ SA+ Sbjct: 1123 TLSRLYPQEFSGFPDVVFTQQFINKDNGMLVPG--LSANEHHNGASAA 1168 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,105,999 Number of Sequences: 219361 Number of extensions: 1241068 Number of successful extensions: 2860 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2860 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)