| Clone Name | rbastl02e03 |
|---|---|
| Clone Library Name | barley_pub |
>DCUP_YERPE (Q8ZAQ7) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD)| Length = 355 Score = 28.5 bits (62), Expect = 4.1 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = -1 Query: 386 DVQQRKLFRVCITVTVL*TDI----PLLALHLYIAMGHGPRFM-PYSPRRDIHKL 237 +V + L R + +L +DI + L LY G GPRF P + R D+ KL Sbjct: 58 EVTMQPLRRYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFQSPITCRADVEKL 112
>NU5M_CHIMO (Q94RJ2) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 612 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -1 Query: 332 TDIPLLALHLYIAMGHGPRFMPYSPRRDIHKL 237 T I L L + MGH PRF+P SP + HKL Sbjct: 421 TAIYSLRLISFTMMGH-PRFLPVSPINENHKL 451
>ATP6_ALBCO (P48893) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 214 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 228 LTTQFMDVPSRAIWHKPWSMSHGNVQMES*QRYVSLQYCNSDTHTKKFSLLYI 386 LT F+ V IW+K WSM N+ +Y++ N+ T+ SLL I Sbjct: 19 LTPMFLSV--FMIWNKTWSMDQNNI-----IKYLAASNWNNSTYNLTKSLLTI 64
>COX10_YARLI (Q6C0L2) Protoheme IX farnesyltransferase, mitochondrial precursor| (EC 2.5.1.-) (Heme O synthase) Length = 471 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -3 Query: 123 CRDCCVYSVC-WWHVFAAKMCNKLMMWWSF 37 C Y+V WW V + + N M WW+F Sbjct: 374 CVGLSYYNVTDWWFVLDSSVLNAWMAWWAF 403
>MRP4_ARATH (Q7DM58) Multidrug resistance-associated protein 4 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 4) (ATP-energized glutathione S-conjugate pump 4) Length = 1516 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Frame = +3 Query: 201 VGNDQPYVELTTQFMDVPSRAIWHKPWSMS------HGNVQME 311 V N VE QF D+PS + W + ++ HGNV +E Sbjct: 1235 VENKMVSVERIKQFTDIPSESEWERKETLPPSNWPFHGNVHLE 1277
>MURD_SYNEL (Q8DMN8) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 454 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Frame = +2 Query: 245 GCPVSGYMA*---TLVHVPWQC---TDGELTTVCQSTVL*Q 349 G PV G +A TL H+PW C T+G+ TT + + Q Sbjct: 94 GIPVRGEVAIAWQTLAHLPWVCITGTNGKTTTTALTAAIFQ 134 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,523,512 Number of Sequences: 219361 Number of extensions: 1019968 Number of successful extensions: 1918 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1918 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)