| Clone Name | rbastl01f11 |
|---|---|
| Clone Library Name | barley_pub |
>TBG_SCHPO (P25295) Tubulin gamma chain (Gamma tubulin)| Length = 446 Score = 30.0 bits (66), Expect = 2.6 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +3 Query: 84 SCVFLFKNTAMQYTRPKKKNILFL*QYKKRAL 179 S LFK T QY R +K+N FL QYKK A+ Sbjct: 383 SIASLFKRTLDQYDRLRKRN-AFLEQYKKEAI 413
>SUMF1_MOUSE (Q8R0F3) Sulfatase-modifying factor 1 precursor| (C-alpha-formyglycine-generating enzyme 1) Length = 372 Score = 28.9 bits (63), Expect = 5.8 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -3 Query: 377 EHANGSAGL*TRGICGCWTSCEANSDGGKIAVNHLSRAASQPRL 246 E G+A L G CGC T A + G A SR A+ P L Sbjct: 36 EAREGAASL--AGSCGCGTPQRAGAHGSSAAAQRYSREANAPGL 77
>BAZ2A_MOUSE (Q91YE5) Bromodomain adjacent to zinc finger domain 2A (Transcription| termination factor I-interacting protein 5) (TTF-I-interacting protein 5) (Tip5) Length = 1850 Score = 28.9 bits (63), Expect = 5.8 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 295 PPSEFASQEVQHPHIPLV*SPALPLACSGTW 387 PPS+F Q QH L P P CSG W Sbjct: 1357 PPSKFFKQVEQHYLTQLTAQPIPPEMCSGWW 1387
>TBG_EMENI (P18695) Tubulin gamma chain (Gamma tubulin)| Length = 454 Score = 28.5 bits (62), Expect = 7.6 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +3 Query: 84 SCVFLFKNTAMQYTRPKKKNILFL*QYKKRA 176 S LFK QY R +K+N FL QYKK A Sbjct: 382 SVATLFKRIVQQYDRLRKRN-AFLEQYKKEA 411
>PDE1_CAEEL (O18696) Probable 3',5'-cyclic phosphodiesterase pde-1 (EC| 3.1.4.17) Length = 664 Score = 28.5 bits (62), Expect = 7.6 Identities = 19/52 (36%), Positives = 24/52 (46%) Frame = +1 Query: 283 TAIFPPSEFASQEVQHPHIPLV*SPALPLACSGTWTASPKGLKYVQNGHAVK 438 T IF F Q+V IP + + C TW+ SP L V GHA+K Sbjct: 242 TGIFFEKLFRKQQVVQCPIPPEIAELMKEVC--TWSFSPFQLNEVSEGHALK 291
>VIT1_PERAM (Q9U8M0) Vitellogenin 1 precursor (Vg-1)| Length = 1896 Score = 28.1 bits (61), Expect = 9.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 306 ICFAGSPAPAYSPGLEPSAAVGMFRDLDCFTKGP 407 ICF+ P P +P +P+ + C TKGP Sbjct: 1826 ICFSMRPLPECAPRFKPADTLKKKIKFHCLTKGP 1859
>GTRA_SHIFL (P37785) Bactoprenol-linked glucose translocase| Length = 124 Score = 28.1 bits (61), Expect = 9.9 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 16/95 (16%) Frame = +1 Query: 31 SIHRGICVLCYKNVAY-----NIPVFFYSKTLP------CSILDQKKRT----YCFFSSI 165 ++H G+ CY N+A+ NI F + T CS + + FF Sbjct: 24 ALHWGVFYACYNNLAFGQGRSNIVGFICAATFSFFANARCSFKVSATKARYFIFIFFMGA 83 Query: 166 RSVLFTILFELNYFTNLTGKLVTSLFK-SLGWLAA 267 S LF +LF+L + + SLF LG+ A+ Sbjct: 84 MSYLFGVLFDLLALSPIFTLFTFSLFSLVLGYCAS 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,461,041 Number of Sequences: 219361 Number of extensions: 1391681 Number of successful extensions: 3630 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3630 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)