| Clone Name | rbastl01e03 |
|---|---|
| Clone Library Name | barley_pub |
>SPIKE_CVMA5 (P11224) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1 (90B); Spike protein S2 (90A)] Length = 1324 Score = 35.4 bits (80), Expect = 0.034 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Frame = +3 Query: 174 PNNNFFTSGAQKYTMYKLDRNLVHKEVLCEELGS--TMLFVVNGNGSEFSEVAGNFPYEL 347 PN T KY +Y + V KEV + S T+L+ VNGN + F ++ N Y + Sbjct: 571 PNTEVVTGICVKYDLYGITGQGVFKEVKADYYNSWQTLLYDVNGNLNGFRDLTTNKTYTI 630 Query: 348 RAFFT 362 R+ ++ Sbjct: 631 RSCYS 635
>SPIKE_CVMJH (P11225) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1 (90B); Spike protein S2 (90A)] Length = 1235 Score = 32.3 bits (72), Expect = 0.29 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +3 Query: 174 PNNNFFTSGAQKYTMYKLDRNLVHKEVLCEELGS--TMLFVVNGNGSEFSEVAGNFPYEL 347 PN T +Y +Y + V KEV + S +L+ VNGN + F ++ N Y + Sbjct: 482 PNTEVATGVCVRYDLYGITGQGVFKEVKADYYNSWQALLYDVNGNLNGFRDLTTNKTYTI 541 Query: 348 RAFFT 362 R+ ++ Sbjct: 542 RSCYS 546
>SPIKE_CVMJC (Q02385) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1 (90B); Spike protein S2 (90A)] Length = 1376 Score = 32.3 bits (72), Expect = 0.29 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +3 Query: 174 PNNNFFTSGAQKYTMYKLDRNLVHKEVLCEELGS--TMLFVVNGNGSEFSEVAGNFPYEL 347 PN T +Y +Y + V KEV + S +L+ VNGN + F ++ N Y + Sbjct: 623 PNTEVATGVCVRYDLYGITGQGVFKEVKADYYNSWQALLYDVNGNLNGFRDLTTNKTYTI 682 Query: 348 RAFFT 362 R+ ++ Sbjct: 683 RSCYS 687
>SPIKE_CVM4 (P22432) Spike glycoprotein precursor (Peplomer protein) (E2)| [Contains: Spike protein S1 (90B); Spike protein S2 (90A)] Length = 1376 Score = 32.3 bits (72), Expect = 0.29 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +3 Query: 174 PNNNFFTSGAQKYTMYKLDRNLVHKEVLCEELGS--TMLFVVNGNGSEFSEVAGNFPYEL 347 PN T +Y +Y + V KEV + S +L+ VNGN + F ++ N Y + Sbjct: 623 PNTEVATGVCVRYDLYGITGQGVFKEVKADYYNSWQALLYDVNGNLNGFRDLTTNKTYTI 682 Query: 348 RAFFT 362 R+ ++ Sbjct: 683 RSCYS 687
>URE2_BLOPB (Q492E8) Urease beta subunit (EC 3.5.1.5) (Urea amidohydrolase beta| subunit) Length = 102 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -3 Query: 138 GRFYTKELVKYTGMCKTDFCFCDTSQFVLD 49 G+F T ELVKY G CK + FC LD Sbjct: 74 GQFRTVELVKYAGACKI-YGFCKAIMGKLD 102
>KNTC1_MOUSE (Q8C3Y4) Kinetochore-associated protein 1| Length = 2207 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 11 LLTTWLLPTTISISKTN*LVSQKQKSVLHMPVYL 112 LL WL P+T+ K + ++ VLH VYL Sbjct: 1818 LLEKWLCPSTVPSEKASEFFELEEDEVLHRVVYL 1851
>NTP1_YMTV (Q9QB93) Nucleoside triphosphatase I (EC 3.6.1.15) (Nucleoside| triphosphate phosphohydrolase I) (NPH I) Length = 631 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = +3 Query: 228 DRNLVHKEVLCEELGSTMLFVVNGNGSEFSEVAGN 332 ++NLV+++ L ++LG ++VN S F +V G+ Sbjct: 214 NKNLVNEKELIDKLGGICSYIVNDEFSIFDDVEGS 248
>RL32_ASHGO (Q751I7) 60S ribosomal protein L32| Length = 131 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -1 Query: 218 HCIFLCPRSKEIVVRLLHLGTLFLAIEGDFTQKNLSSILACVKQIFVFVT 69 H +L K++ V ++H T I + + KN SILA K + + VT Sbjct: 72 HKTYLVSNIKDLEVLMMHTKTYAAEIASNVSSKNRVSILARAKALGIKVT 121
>RTCA_ANASP (Q8YVS3) Probable RNA 3'-terminal phosphate cyclase (EC 6.5.1.4)| (RNA-3'-phosphate cyclase) (RNA cyclase) Length = 348 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 201 AQKYTMYKLDRNLVHKEVLCEELGSTMLFVVNGNGSEFSEVAGNFPYEL 347 AQ T + + H E+ + LGSTML + G G + AGN+ +++ Sbjct: 46 AQHLTAVRAAARICHGELQGDALGSTMLEFIPGGGVK----AGNYIFDV 90
>CND1_YEAST (Q06156) Condensin complex subunit 1 (XCAP-D2 homolog)| Length = 1176 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 123 KELVKYTGMCKTDFCFCDTSQFVLDMEIVVGNNQVVNRFC 4 KEL G + DF D QFV + E++ G ++ +FC Sbjct: 900 KELEMIGGTNEDDFT--DAIQFVKENELLFGEKSILGKFC 937
>SCN1_LOLBL (Q05973) Sodium channel protein I, brain| Length = 1522 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -1 Query: 218 HCIFLCPRSKEIVVRLLHLGTLFLAIEGDFTQKNLSSILACVKQIFVFV 72 HCI ++ ++ ++ L T+FLA+E L ++L +F V Sbjct: 405 HCIITDSFTEVFIIFIIVLNTVFLAMEHHGMSMELKNVLKVANYVFTTV 453
>MTR_BUFMA (Q90252) Mesotocin receptor (MTR)| Length = 389 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 118 FFCVKSPSIAKNKVPRCSNLTTISLLLGHKNIQCTSWI 231 FF V+ S+ P+ ++L I++LLG N C WI Sbjct: 290 FFFVQMWSVWDPNPPKEASLFIIAMLLGSLNSCCNPWI 327
>ALG2_CANAL (Q59LF2) Alpha-1,3-mannosyltransferase ALG2 (EC 2.4.1.-)| (GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase) (Asparagine-linked glycosylation protein 2) Length = 428 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/65 (26%), Positives = 30/65 (46%) Frame = +3 Query: 135 SLNSQKQSS*M*QPNNNFFTSGAQKYTMYKLDRNLVHKEVLCEELGSTMLFVVNGNGSEF 314 S+++Q ++S + Q +T + + + L+ L VL G + VVN NG+ Sbjct: 310 SISTQLKNSLIQQTELLLYTPPREHFGIVPLEAMLAKTPVLAINFGGPLETVVNYNGNNL 369 Query: 315 SEVAG 329 E G Sbjct: 370 DEATG 374 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,186,432 Number of Sequences: 219361 Number of extensions: 1136749 Number of successful extensions: 2649 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2649 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)