| Clone Name | rbastl01c07 |
|---|---|
| Clone Library Name | barley_pub |
>VCY2_HUMAN (O14599) Testis-specific basic protein Y 2 (Variably charged| protein Y 2) Length = 106 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 309 GKDGMARPCGRSNVQLLRDSYKAFCYTKNL 220 G+D + PC R + LL + +C TKNL Sbjct: 13 GQDHYSHPCPRFSQVLLTEGIMTYCLTKNL 42
>Y431_NANEQ (P61151) UPF0215 protein NEQ431| Length = 198 Score = 28.5 bits (62), Expect = 4.0 Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +1 Query: 196 TTFSYRYFQIFGVAK-----CFIRIAQQLNIASPTWSCHAIFPGTTSMRVAPRRLGNDS 357 T F Y Y+Q++G+ K +A I P H I G T + R G DS Sbjct: 134 TPFGYTYYQVYGIDKDTASNIINNLAIVSKIPEPARVAHMIARGVTKGDSSKPRAGGDS 192
>FEOB2_PORGI (Q7MVL1) Ferrous iron transport protein B homolog| Length = 725 Score = 28.1 bits (61), Expect = 5.2 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = +3 Query: 30 ILV*CSVLHTTFVDWNTGYPNRWNLFLLQSLFNILHTTLVDWNTGYRNRWTAG 188 +L+ VL T V N YP++W L SL ILH L TG+ W +G Sbjct: 327 LLMLALVLWITIVGSN--YPSQW---LSDSLVGILHPLLKTRATGFLPDWLSG 374
>CTLA4_RABIT (P42072) Cytotoxic T-lymphocyte protein 4 precursor (Cytotoxic| T-lymphocyte-associated antigen 4) (CTLA-4) (CD152 antigen) Length = 223 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 244 FIRIAQQLNIASPTWSCHAIF 306 F R QL++AS TWSC A+F Sbjct: 6 FQRQGTQLDLASRTWSCAALF 26
>TEGU_EBV (P03186) Large tegument protein| Length = 3149 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 11/51 (21%) Frame = +1 Query: 1 AQIQNLFLLQSLFNVL-----------FYIPLLWTGIQATQTDGTFFYYNP 120 AQI N ++QSL VL YI ++ G +TDG+F+ ++P Sbjct: 144 AQIANSAVVQSLAEVLHGSYNGVAQFILYICDIYAGAIIIETDGSFYLFDP 194
>CAN10_RAT (Q9ES66) Calpain-10 (EC 3.4.22.-) (Calcium-activated neutral| proteinase 10) (CANP 10) Length = 666 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 7/60 (11%) Frame = -3 Query: 395 PWEG-----LLCICWNRMESFPRRRGATRIDVV--PGKMAWQDHVGEAMFSCCAIRIKHF 237 PWEG LL CW ++ +D V PG+ W D + F+C + H+ Sbjct: 60 PWEGQVKQGLLGDCWFLCACAALQKSRHLLDQVFPPGQPGWSDQEYQGFFTCRIWQFGHW 119
>CAN10_MOUSE (Q9ESK3) Calpain-10 (EC 3.4.22.-) (Calcium-activated neutral| proteinase 10) (CANP 10) Length = 666 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 7/60 (11%) Frame = -3 Query: 395 PWEG-----LLCICWNRMESFPRRRGATRIDVV--PGKMAWQDHVGEAMFSCCAIRIKHF 237 PWEG LL CW ++ +D V PG+ W D + F+C + H+ Sbjct: 60 PWEGQVKQGLLGDCWFLCACAALQKSQHLLDQVFPPGQPGWSDQKYQGFFTCRIWQFGHW 119
>Y527_MYCPN (P75251) Hypothetical protein MG350.1 homolog (G12_orf225)| Length = 225 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +3 Query: 81 GYPNRWN-LFLLQSLFNILHTTLV 149 G PN W +F L SLFN++ TLV Sbjct: 179 GVPNYWGGIFALYSLFNVIKFTLV 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,262,617 Number of Sequences: 219361 Number of extensions: 1333741 Number of successful extensions: 2830 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2830 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)