| Clone Name | rbastl01a11 |
|---|---|
| Clone Library Name | barley_pub |
>PI3K2_SOYBN (P42348) Phosphatidylinositol 3-kinase, nodule isoform (EC| 2.7.1.137) (PI3-kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-1) Length = 812 Score = 52.8 bits (125), Expect = 5e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 N+SVSALFPQMVETIHRWAQYWR Sbjct: 790 NESVSALFPQMVETIHRWAQYWR 812
>PI3K_ARATH (P42339) Phosphatidylinositol 3-kinase VPS34 (EC 2.7.1.137)| (PtdIns-3-kinase VSP34) (PI3-kinase VPS34) (PI3K VPS34) (AtVPS34) Length = 814 Score = 52.8 bits (125), Expect = 5e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 N+SVSALFPQMVETIHRWAQYWR Sbjct: 792 NESVSALFPQMVETIHRWAQYWR 814
>PI3K1_SOYBN (P42347) Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.137)| (PI3-kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5) Length = 814 Score = 52.8 bits (125), Expect = 5e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 N+SVSALFPQMVETIHRWAQYWR Sbjct: 792 NESVSALFPQMVETIHRWAQYWR 814
>PI3K4_DICDI (P54676) Phosphatidylinositol 3-kinase VPS34-like (EC 2.7.1.137)| (PI3-kinase) (PtdIns-3-kinase) (PI3K) Length = 816 Score = 40.0 bits (92), Expect = 0.003 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 NDSV+ALFP ++E H+W QYW+ Sbjct: 793 NDSVTALFPVIIEMAHKWLQYWK 815
>PK3C3_XENLA (Q6AZN6) Phosphatidylinositol 3-kinase catalytic subunit type 3 (EC| 2.7.1.137) (PtdIns-3-kinase type 3) (PI3-kinase type 3) (PI3K type 3) (Phosphoinositide-3-kinase class 3) Length = 886 Score = 37.0 bits (84), Expect = 0.026 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 +DSV+ALF +VE IH++AQYWR Sbjct: 863 DDSVNALFAAVVEQIHKFAQYWR 885
>VPS34_SCHPO (P50520) Phosphatidylinositol 3-kinase vps34 (EC 2.7.1.137)| (PtdIns-3-kinase vps34) (PI3-kinase vps34) (PI3K vps34) (Vacuolar sorting protein 34) Length = 801 Score = 36.2 bits (82), Expect = 0.045 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 NDSVSALFPQ+++ +H AQY R Sbjct: 778 NDSVSALFPQIIDRMHNLAQYMR 800
>PK3C3_RAT (O88763) Phosphatidylinositol 3-kinase catalytic subunit type 3 (EC| 2.7.1.137) (PtdIns-3-kinase type 3) (PI3-kinase type 3) (PI3K type 3) (Phosphoinositide-3-kinase class 3) Length = 887 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 ++SV ALF +VE IH++AQYWR Sbjct: 864 DESVHALFAAVVEQIHKFAQYWR 886
>PK3C3_PIG (Q5D891) Phosphatidylinositol 3-kinase catalytic subunit type 3 (EC| 2.7.1.137) (PtdIns-3-kinase type 3) (PI3-kinase type 3) (PI3K type 3) (Phosphoinositide-3-kinase class 3) Length = 887 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 ++SV ALF +VE IH++AQYWR Sbjct: 864 DESVHALFAAVVEQIHKFAQYWR 886
>PK3C3_MOUSE (Q6PF93) Phosphatidylinositol 3-kinase catalytic subunit type 3 (EC| 2.7.1.137) (PtdIns-3-kinase type 3) (PI3-kinase type 3) (PI3K type 3) (Phosphoinositide-3-kinase class 3) Length = 887 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 ++SV ALF +VE IH++AQYWR Sbjct: 864 DESVHALFAAVVEQIHKFAQYWR 886
>PK3C3_HUMAN (Q8NEB9) Phosphatidylinositol 3-kinase catalytic subunit type 3 (EC| 2.7.1.137) (PtdIns-3-kinase type 3) (PI3-kinase type 3) (PI3K type 3) (Phosphoinositide-3-kinase class 3) (Phosphatidylinositol 3-kinase p100 subunit) Length = 887 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 ++SV ALF +VE IH++AQYWR Sbjct: 864 DESVHALFAAVVEQIHKFAQYWR 886
>VPS34_YEAST (P22543) Phosphatidylinositol 3-kinase VPS34 (EC 2.7.1.137)| (PtdIns-3-kinase VPS34) (PI3-kinase VPS34) (PI3K VPS34) (Vacuolar sorting protein 34) (Vacuolar protein targeting protein 29) Length = 875 Score = 34.3 bits (77), Expect = 0.17 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 NDSV+AL P +++ +H AQYWR Sbjct: 852 NDSVNALLPIVIDHLHNLAQYWR 874
>VPS34_CANAL (Q92213) Phosphatidylinositol 3-kinase VPS34 (EC 2.7.1.137)| (PtdIns-3-kinase VPS34) (PI3-kinase VPS34) (PI3K VPS34) (Vacuolar sorting protein 34) Length = 1020 Score = 33.1 bits (74), Expect = 0.38 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 476 NDSVSALFPQMVETIHRWAQYWR 408 NDSV+A P +++ +H AQYWR Sbjct: 997 NDSVNAFLPVVIDRLHSLAQYWR 1019
>DSCR2_HUMAN (O95456) Down syndrome critical region protein 2 (Leucine-rich| protein C21-LRP) Length = 288 Score = 28.5 bits (62), Expect = 9.4 Identities = 12/44 (27%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -2 Query: 133 IWSACDVIGIYNMWW*CVDRPRKKSVTSGCLFYSLPNN-GIFIC 5 +W ++N W D S + C+FY L +N +F+C Sbjct: 92 VWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLC 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,506,163 Number of Sequences: 219361 Number of extensions: 1333768 Number of successful extensions: 2969 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2969 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)