| Clone Name | rbast78a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EMP1_PONPY (Q5RCY3) Epithelial membrane protein 1 (EMP-1) | 28 | 8.4 | 2 | EMP1_HUMAN (P54849) Epithelial membrane protein 1 (EMP-1) (Tumor... | 28 | 8.4 |
|---|
>EMP1_PONPY (Q5RCY3) Epithelial membrane protein 1 (EMP-1)| Length = 157 Score = 28.5 bits (62), Expect = 8.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 124 FMAWNLTTVCWISQSIGHQL*PSQLTNRTHTDYH 225 F++ T VCW+ +G + S NR T YH Sbjct: 96 FLSGATTLVCWLCILVGVSIYTSHYANRDGTQYH 129
>EMP1_HUMAN (P54849) Epithelial membrane protein 1 (EMP-1) (Tumor-associated| membrane protein) (CL-20) (B4B protein) Length = 157 Score = 28.5 bits (62), Expect = 8.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 124 FMAWNLTTVCWISQSIGHQL*PSQLTNRTHTDYH 225 F++ T VCW+ +G + S NR T YH Sbjct: 96 FLSGATTLVCWLCILVGVSIYTSHYANRDGTQYH 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,814,224 Number of Sequences: 219361 Number of extensions: 1220913 Number of successful extensions: 2065 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2065 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)