| Clone Name | rbast77d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AKAP5_BOVIN (P24275) A-kinase anchor protein 5 (A-kinase anchor ... | 29 | 2.4 | 2 | WISP2_HUMAN (O76076) WNT1-inducible signaling pathway protein 2 ... | 28 | 7.1 | 3 | CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (C... | 28 | 7.1 |
|---|
>AKAP5_BOVIN (P24275) A-kinase anchor protein 5 (A-kinase anchor protein 75 kDa)| (AKAP 75) (cAMP-dependent protein kinase regulatory subunit II high affinity binding protein) (P75) Length = 428 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 127 ADAAQNLQP*RRANQRSSYYTGRWSNLHCTFARRPRSNGNYQNNP 261 ADAA+ P RA+ + G W ++ RR RS + Q P Sbjct: 56 ADAAKKCPPEARASDQPQRPGGAWDSIKRLVTRRKRSESSKQQKP 100
>WISP2_HUMAN (O76076) WNT1-inducible signaling pathway protein 2 precursor| (WISP-2) (Connective tissue growth factor-like protein) (CTGF-L) (Connective tissue growth factor-related protein 58) Length = 250 Score = 27.7 bits (60), Expect = 7.1 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 201 TPSARVVTAALICSASRLKVLCCIGPCAC 115 TP ++ +L+C S+++ C PC C Sbjct: 4 TPKTHLLAFSLLCLLSKVRTQLCPTPCTC 32
>CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (Complement C3d| receptor) (CD21 antigen) Length = 1025 Score = 27.7 bits (60), Expect = 7.1 Identities = 18/75 (24%), Positives = 31/75 (41%) Frame = -1 Query: 286 QYVVSVSSRGCFGSFRLIWACVQKCSVNYSIGPCSNCCVDLLCVKAEGSVLHRPMCLFSS 107 Q++ + + C F+L + Q C C ++ C V+H +SS Sbjct: 477 QFIRTAVNSSCDEGFQLSESAYQLCQGTIPWFIEIRLCKEITCPPPP--VIHNGTHTWSS 534 Query: 106 ASGLAVGGVVTFFCY 62 + + G VVT+ CY Sbjct: 535 SEDVPYGTVVTYMCY 549 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,460,113 Number of Sequences: 219361 Number of extensions: 702284 Number of successful extensions: 1872 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1872 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)