| Clone Name | rbast74h02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTR2_ARATH (P46032) Peptide transporter PTR2 (Histidine-transpor... | 75 | 8e-14 | 2 | CHL1_ARATH (Q05085) Nitrate/chlorate transporter | 51 | 2e-06 | 3 | RD23A_MOUSE (P54726) UV excision repair protein RAD23 homolog A ... | 29 | 4.7 | 4 | UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (E... | 29 | 6.2 | 5 | UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (E... | 29 | 6.2 |
|---|
>PTR2_ARATH (P46032) Peptide transporter PTR2 (Histidine-transporting protein)| Length = 585 Score = 75.1 bits (183), Expect = 8e-14 Identities = 34/50 (68%), Positives = 38/50 (76%) Frame = -2 Query: 447 TTRGGKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKKTA 298 TTR G++GWI DNLN GHLDYFFWLLA LSLVN AVY A+ Y KK + Sbjct: 535 TTRNGQEGWISDNLNSGHLDYFFWLLAGLSLVNMAVYFFSAARYKQKKAS 584
>CHL1_ARATH (Q05085) Nitrate/chlorate transporter| Length = 590 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/45 (44%), Positives = 29/45 (64%) Frame = -2 Query: 438 GGKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTYKK 304 G WI D+LN G L F+WL+A L +NF ++L+ + WY YK+ Sbjct: 526 GKAHPWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWYVYKE 570
>RD23A_MOUSE (P54726) UV excision repair protein RAD23 homolog A (mHR23A)| Length = 363 Score = 29.3 bits (64), Expect = 4.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 304 LLVGVPAGDEQVDGEVDEAERGEQP 378 LL G+P E G V E++R EQP Sbjct: 198 LLTGIPGSPEPEHGSVQESQRAEQP 222
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 192 IMFCLLNTFRHQSQTEHVSQSLTDHELLLWRPEN 293 I CL FRH S T H SL L+ P N Sbjct: 567 IPVCLREKFRHSSYTHHTGSSLFGQPFLMAIPRN 600
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 28.9 bits (63), Expect = 6.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 192 IMFCLLNTFRHQSQTEHVSQSLTDHELLLWRPEN 293 I CL FRH S T H SL L+ P N Sbjct: 567 IPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRN 600 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,258,042 Number of Sequences: 219361 Number of extensions: 846487 Number of successful extensions: 2065 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2065 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)