| Clone Name | rbast74f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYQ_XYLFA (Q9PDP1) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glu... | 29 | 3.4 | 2 | KCC4_YEAST (P25389) Probable serine/threonine-protein kinase KCC... | 28 | 4.4 | 3 | SCPA_CLOAB (Q97HF0) Segregation and condensation protein A | 28 | 5.7 | 4 | SEM2A_DROME (Q24323) Semaphorin-2A precursor (Semaphorin-II) (Se... | 27 | 9.8 |
|---|
>SYQ_XYLFA (Q9PDP1) Glutaminyl-tRNA synthetase (EC 6.1.1.18) (Glutamine--tRNA| ligase) (GlnRS) Length = 580 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = +3 Query: 177 NDINQTTVSAAPRREDFLRSSKGKSLAHG-----RSSFMPRAN 290 ++I T A P ++DF+R + LAHG R+ F P N Sbjct: 2 SEITSTDARAQPEKKDFIRQIIREDLAHGTHTHIRTRFPPEPN 44
>KCC4_YEAST (P25389) Probable serine/threonine-protein kinase KCC4 (EC| 2.7.11.1) Length = 1037 Score = 28.5 bits (62), Expect = 4.4 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +3 Query: 102 RNKVSTAKTRAAVHQNRYKYNNISSNDINQTTVSAAPRREDFLRSSKGKSLAHGRSSFMP 281 RNK+ K ++ ++ SS +N ++ + PRR R S+ S + RSSF+ Sbjct: 376 RNKIKKTKK----NKRSSTLSSSSSLLLNNRSIQSTPRRRTSKRHSREFSSSRKRSSFLL 431 Query: 282 RANSCECS 305 +N + S Sbjct: 432 SSNPTDSS 439
>SCPA_CLOAB (Q97HF0) Segregation and condensation protein A| Length = 249 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 85 VTILIRNLGSRFDFFNHLIRDNKNDIY 5 + I I N FD HLIR NK DIY Sbjct: 3 LNINIDNFQGPFDLLLHLIRKNKMDIY 29
>SEM2A_DROME (Q24323) Semaphorin-2A precursor (Semaphorin-II) (Sema II)| Length = 724 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 150 RYKYNNISSNDINQTTVSAAPRREDFLRS-SKGKS 251 R NISS++ N+ ++ P R+D + SKGKS Sbjct: 90 RVNLQNISSSNCNRDVINLEPTRDDVVSCVSKGKS 124 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,829,689 Number of Sequences: 219361 Number of extensions: 550099 Number of successful extensions: 1841 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1840 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)