| Clone Name | rbast73g06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TSC1_HUMAN (Q92574) Hamartin (Tuberous sclerosis 1 protein) | 29 | 3.9 | 2 | MSN2_YEAST (P33748) Zinc finger protein MSN2 (Multicopy suppress... | 29 | 5.1 | 3 | CAUP_DROME (P54269) Homeobox protein caupolican | 29 | 5.1 | 4 | IL16_SAISC (O62677) Interleukin-16 precursor (IL-16) (Lymphocyte... | 28 | 6.7 | 5 | SILP_SALTY (Q9ZHC7) Putative cation-transporting P-type ATPase (... | 28 | 8.8 |
|---|
>TSC1_HUMAN (Q92574) Hamartin (Tuberous sclerosis 1 protein)| Length = 1164 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -2 Query: 345 SDESQAGCSQRRITADTGIFQPSACKI 265 +DES AG + + + +T IF PS CKI Sbjct: 562 ADESPAGDRECQTSLETSIFTPSPCKI 588
>MSN2_YEAST (P33748) Zinc finger protein MSN2 (Multicopy suppressor of SNF1| protein 2) Length = 704 Score = 28.9 bits (63), Expect = 5.1 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 52 HPNIREEALHDLQKSFSQNKNFHMHIQVKKPKHG 153 H N R A H K FS++ N HI+ K KHG Sbjct: 670 HSNERPFACHICDKKFSRSDNLSQHIKTHK-KHG 702
>CAUP_DROME (P54269) Homeobox protein caupolican| Length = 693 Score = 28.9 bits (63), Expect = 5.1 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +1 Query: 22 SYCSSTTTAEHPNIREEALHDLQKSFSQNKNFHMHIQVKKPKHGTPPDKYHKEE 183 SY S T HP+ ++ H Q+ QN+ H Q+ +P + P Y +EE Sbjct: 385 SYAQSHNTHTHPHPQQMQHHQQQQQQQQNQQQLQHHQMDQPYY--HPGGYGQEE 436
>IL16_SAISC (O62677) Interleukin-16 precursor (IL-16) (Lymphocyte| chemoattractant factor) (LCF) Length = 627 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -3 Query: 413 VTRNPPAGRSGVERTLREKKPSALMKVRPGARRGASQPILAFFSQARAKF 264 V+ +PP GR E+TL P L+++ P + P+L SQ F Sbjct: 214 VSESPPPGRQPSEKTL-PPSPDPLLRLLPTQTEESQGPVLKMPSQRARSF 262
>SILP_SALTY (Q9ZHC7) Putative cation-transporting P-type ATPase (EC 3.6.3.-)| Length = 824 Score = 28.1 bits (61), Expect = 8.8 Identities = 24/88 (27%), Positives = 38/88 (43%), Gaps = 6/88 (6%) Frame = +1 Query: 16 ELSYCSSTTTAE---HPNIREEALHDLQKSFSQNKNFHMHIQVKKPKHGTPPDKY---HK 177 +L +CS++ ++ HP+ H + S++ + H H H PDK H+ Sbjct: 65 QLYFCSASCESKFKAHPD------HYFTEDASEHHHHHDH-------HEVSPDKIKQSHR 111 Query: 178 EEEKTIFLNVHTCQPA*NNLRQGPKNQP 261 + EK I V TC R GP + P Sbjct: 112 QAEKEISEGVWTCPMHPEIRRSGPGSCP 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,031,408 Number of Sequences: 219361 Number of extensions: 1254011 Number of successful extensions: 3261 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3259 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)