ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast73c08 |
|---|---|
| Clone Library Name | barley_pub |
>LGT_CITUN (Q9MB73) Limonoid UDP-glucosyltransferase (EC 2.4.1.210) (Limonoid| glucosyltransferase) (Limonoid GTase) (LGTase) Length = 511 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = -1 Query: 256 EWKRVVAEALGKDGSSDRNLRAFVEGI 176 +WK+ EA+ GSSDRN++AFV+ + Sbjct: 438 KWKKEAEEAVADGGSSDRNIQAFVDEV 464
>RPOA_PRRSL (Q04561) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP Length = 3859 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 219 TARRIVI*GHSWRASLAVSPYD 154 TA R V+ WRA LAV+PYD Sbjct: 3739 TANRKVVRTTDWRADLAVTPYD 3760
>NOEE_RHISN (P55472) Nodulation protein noeE (EC 2.8.2.-)| Length = 419 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 245 PLPFRCRAPSTPRSGLTVLRHLL 313 PLP C PRSG T+L HLL Sbjct: 7 PLPLICFLLGIPRSGTTLLAHLL 29
>IAAG_MAIZE (Q41819) Indole-3-acetate beta-glucosyltransferase (EC 2.4.1.121)| (IAA-Glu synthetase) ((Uridine 5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl transferase) Length = 471 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = -1 Query: 319 RLKEVTQDXXXXXXXXXXXASEWKRVVAEALGKDGSSDRNLRAFVE 182 R D A EW+ A+ GSSDRNL FV+ Sbjct: 417 RCVRAVMDGGEAASAARKAAGEWRDRARAAVAPGGSSDRNLDEFVQ 462
>BRNQ_SALTY (P0A1W8) Branched-chain amino acid transport system II carrier| protein (LIV-II) Length = 439 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +3 Query: 63 NHTLGCQVNIVLVHLPSCQASHLSSYATSWYHKETLLMMPS 185 +H + + ++ P C A + S+ SW+H T ++ P+ Sbjct: 334 SHLIQISIPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPA 374
>BRNQ_SALTI (P0A1W9) Branched-chain amino acid transport system II carrier| protein (LIV-II) Length = 439 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +3 Query: 63 NHTLGCQVNIVLVHLPSCQASHLSSYATSWYHKETLLMMPS 185 +H + + ++ P C A + S+ SW+H T ++ P+ Sbjct: 334 SHLIQISIPVLTAIYPPCIALVVLSFTRSWWHNSTRIIAPA 374
>ACSA_AGRT5 (Q8UBV5) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (Acetate--CoA| ligase) (Acyl-activating enzyme) Length = 651 Score = 28.1 bits (61), Expect = 5.8 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 150 WYHKETLLMMPSTNALKLRSDEPSF 224 WYH+E + P +K+R+++P F Sbjct: 236 WYHQEIATVKPDCPPVKMRAEDPLF 260
>FIBP_ADE31 (P36848) Fiber protein (pIV)| Length = 556 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 105 LPSCQASHLSSYATSWYHKETLLMMPSTNALKLRSDEP 218 L SC S L +H ++PS+NAL L + +P Sbjct: 149 LASCSTSKLRGGGNLGFHLPAPFVVPSSNALTLSASDP 186
>ATP6_WHEAT (P68527) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 386 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 282 RGVLGARHRNGSGW 241 R VLGARHRNG W Sbjct: 88 RTVLGARHRNGETW 101
>ATP6_TRITI (P68526) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 386 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 282 RGVLGARHRNGSGW 241 R VLGARHRNG W Sbjct: 88 RTVLGARHRNGETW 101
>APG_BRANA (P40603) Anter-specific proline-rich protein APG (Protein CEX)| (Fragment) Length = 449 Score = 27.7 bits (60), Expect = 7.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 226 PEPQRPPASIPMPCP 270 P+P+ PPA P PCP Sbjct: 32 PQPKPPPAPTPSPCP 46 Score = 27.7 bits (60), Expect = 7.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 226 PEPQRPPASIPMPCP 270 P+P+ PPA P PCP Sbjct: 12 PQPKPPPAPTPSPCP 26
>APG_ARATH (P40602) Anter-specific proline-rich protein APG precursor| Length = 534 Score = 27.3 bits (59), Expect = 9.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 226 PEPQRPPASIPMPCP 270 P+P+ PPA P PCP Sbjct: 95 PQPKPPPAPSPSPCP 109
>FAEA_ASPAW (Q9P979) Feruloyl esterase A precursor (EC 3.1.1.73) (Ferulic acid| esterase A) (FAEA) (Feruloylesterase) Length = 281 Score = 27.3 bits (59), Expect = 9.9 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = -2 Query: 207 IVI*GHSWRASLAVSPYDTSL*RRRKDARLDTTAGAPRLYLLGNPMCGCMARSTVVSSAY 28 + + GHS ASLA A+L T RLY G P G A ++ ++ A+ Sbjct: 148 LTVTGHSLGASLAALTA----------AQLSATYDNIRLYTFGEPRSGNQAFASYMNDAF 197 Query: 27 QSLNLD 10 Q+ + D Sbjct: 198 QASSPD 203 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,009,881 Number of Sequences: 219361 Number of extensions: 838354 Number of successful extensions: 2726 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2721 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
