| Clone Name | rbast73b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CORTO_DROME (P41046) Centrosomal and chromosomal factor (CCF) (C... | 30 | 1.9 | 2 | NSE4_SCHPO (Q6BDR8) Non-structural maintenance of chromosome ele... | 28 | 7.2 |
|---|
>CORTO_DROME (P41046) Centrosomal and chromosomal factor (CCF)| (Chromocentrosomin) Length = 550 Score = 30.4 bits (67), Expect = 1.9 Identities = 17/58 (29%), Positives = 24/58 (41%) Frame = +1 Query: 19 QGSQMQLLITHCSFDHHHPRSTTPMIHSFLIQEKNITLRQQNTSKKVVRLHQPITTSS 192 Q Q Q + HHH + M H+ + + L+QQ + HQP TSS Sbjct: 28 QQQQQQQQHSQTQQQHHHQQQQQHMYHAAVAAHQQQLLQQQQQQQHHRHHHQPANTSS 85
>NSE4_SCHPO (Q6BDR8) Non-structural maintenance of chromosome element 4| (Non-SMC element 4) (DNA repair protein rad62) Length = 300 Score = 28.5 bits (62), Expect = 7.2 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 6/37 (16%) Frame = +1 Query: 106 LIQEKNITLRQQNTSKKVVRL------HQPITTSSFL 198 ++ E+NIT ++ NT+K V+ + HQP+ F+ Sbjct: 166 MLNERNITTQENNTTKNVLHISRLLQAHQPVNFLKFI 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,761,937 Number of Sequences: 219361 Number of extensions: 649372 Number of successful extensions: 1341 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1341 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)