| Clone Name | rbast73a11 |
|---|---|
| Clone Library Name | barley_pub |
>CPN2_MOUSE (Q9DBB9) Carboxypeptidase N subunit 2 precursor (Carboxypeptidase N| polypeptide 2) (Carboxypeptidase N 83 kDa chain) (Carboxypeptidase N regulatory subunit) (Carboxypeptidase N large subunit) Length = 547 Score = 32.3 bits (72), Expect = 0.71 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = +2 Query: 233 SVLTLAAMTSPSAINLSLASGTEAAGLSDFCAPVSLASITKDIPPS-TLLMHLRAMTDTL 409 S+L LA +T P + G + G FC+ LA I DIPP T ++ + T+ Sbjct: 11 SLLLLARLTQPCPV------GCDCFGREVFCSDEQLADIPPDIPPHITDIVFVETAFTTV 64 Query: 410 KTGAGMTLPRRNSIPF 457 +T A P + F Sbjct: 65 RTRAFSGSPNLTKVVF 80
>LOLA4_DROME (Q867Z4) Longitudinals lacking protein, isoforms F/I/K/T| Length = 970 Score = 30.0 bits (66), Expect = 3.5 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +1 Query: 343 EHHKGHPTKHVVDAPESNDGHLEDRSRHDI 432 EHH+ H T H+ + P+++ H + + H + Sbjct: 612 EHHQQHQTIHIEEVPQTSQQHHQQQHHHQL 641
>MASS1_MOUSE (Q8VHN7) Monogenic audiogenic seizure susceptibility protein 1| precursor (Very large G-protein coupled receptor 1) (Neurepin) Length = 6298 Score = 29.6 bits (65), Expect = 4.6 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +2 Query: 260 SPSAINLSLASGTEAAGLSDFCAPVSLASITKDIPPSTLLMHLRAMTDTLKTGAGMTLP 436 SP +++ ASGT AP+SL D+P L + T++ GA ++ P Sbjct: 444 SPVTADITPASGTLQFAQGQMLAPISLVVFDDDLPEEAEAYLLTILPHTIQGGAEVSEP 502
>LRC3B_MOUSE (Q8VCH9) Leucine-rich repeat-containing protein 3B precursor| (Leucine-rich repeat protein LRP15) Length = 259 Score = 29.6 bits (65), Expect = 4.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 296 TEAAGLSDFCAPVSLASITKDIPPSTLLMHL 388 + + GL+ C+ +L I +D+PP T+L++L Sbjct: 41 SSSGGLNVTCSNANLKEIPRDLPPETVLLYL 71
>LRC3B_HUMAN (Q96PB8) Leucine-rich repeat-containing protein 3B precursor| (Leucine-rich repeat protein LRP15) Length = 259 Score = 29.6 bits (65), Expect = 4.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 296 TEAAGLSDFCAPVSLASITKDIPPSTLLMHL 388 + + GL+ C+ +L I +D+PP T+L++L Sbjct: 41 SSSGGLNVTCSNANLKEIPRDLPPETVLLYL 71
>P210L_HUMAN (Q5VU65) Nuclear pore membrane glycoprotein 210-like precursor| (Nucleoporin 210 kDa-like) Length = 1888 Score = 29.3 bits (64), Expect = 6.0 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 266 SAINLSLASGTEAAGLSDFCAPVSLASITKDIPPSTLLMHLRAMTDTL 409 + L + +G L FC P +ITK + P+TL++ ++TL Sbjct: 1577 TVFKLFITTGRNGVNLKGFCTPNQALAITKVLLPATLMLCHVQFSNTL 1624 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,567,506 Number of Sequences: 219361 Number of extensions: 1466780 Number of successful extensions: 4103 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4101 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)