ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast73a06 |
|---|---|
| Clone Library Name | barley_pub |
>GT7_ARATH (O81007) Putative glycosyltransferase 7 (EC 2.4.-.-) (AtGT7)| Length = 449 Score = 36.6 bits (83), Expect = 0.017 Identities = 16/31 (51%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -3 Query: 275 FADDQVLRDYGFRHAG-PLSDDVRPLPFDYP 186 FAD+QV+R YGF H+ + ++P+PFDYP Sbjct: 415 FADNQVMRKYGFVHSDLGKTSPLQPVPFDYP 445
>GT6_ARATH (Q9SZG1) Putative glycosyltransferase 6 (EC 2.4.-.-) (AtGT6)| Length = 432 Score = 36.6 bits (83), Expect = 0.017 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = -3 Query: 275 FADDQVLRDYGFRHAG-PLSDDVRPLPFDYPAAA 177 FAD+QV+R YG+ H+ + ++PLPFDYP A Sbjct: 398 FADNQVMRVYGYVHSDLSKTSPLQPLPFDYPNEA 431
>ORCT2_HUMAN (Q96BI1) Organic cation transporter-like protein 2 (Imprinted| multi-membrane spanning polyspecific transporter-related protein 1) (Efflux transporter-like protein) (Tumor-suppressing subchromosomal transferable fragment candidate gene 5 prote Length = 408 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 Query: 98 RVASFVFVLLLFSTHWMSAVFHFLLLI 18 R + VF+++ + WMS+VFHF LL+ Sbjct: 293 RASVLVFIVVGLAMAWMSSVFHFCLLV 319
>FL3H_MATIN (Q05965) Naringenin,2-oxoglutarate 3-dioxygenase (EC 1.14.11.9)| (Flavonone-3-hydroxylase) (F3H) (FHT) (Fragment) Length = 357 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 16 FISRRKWKTADIQCVLNNNSTKTKLATRQ 102 F+S ++K AD Q V+N+NS++ +AT Q Sbjct: 263 FLSNGRFKNADHQAVVNSNSSRLSIATFQ 291
>GT5_ARATH (Q9CA75) Putative glycosyltransferase 5 (EC 2.4.-.-) (AtGT5)| Length = 457 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 275 FADDQVLRDYGFRHAGPLSDDVR 207 FAD+QVL+ YGF H G LS ++ Sbjct: 406 FADNQVLKLYGFSHRGLLSPKIK 428
>GT4_ARATH (Q9M9U0) Putative glycosyltransferase 4 (EC 2.4.-.-) (AtGT4)| Length = 513 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 275 FADDQVLRDYGFRHAGPLSDDVR 207 FAD+QVL+ YGF H G LS ++ Sbjct: 464 FADNQVLKLYGFSHRGLLSPKIK 486
>FL3H_PETHY (Q07353) Naringenin,2-oxoglutarate 3-dioxygenase (EC 1.14.11.9)| (Flavonone-3-hydroxylase) (F3H) (FHT) (Fragment) Length = 369 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 16 FISRRKWKTADIQCVLNNNSTKTKLATRQ 102 F+S ++K AD Q V+N+NS++ +AT Q Sbjct: 267 FLSNGRFKNADHQAVVNSNSSRLSIATFQ 295
>FL3H_ARATH (Q9S818) Naringenin,2-oxoglutarate 3-dioxygenase (EC 1.14.11.9)| (Flavanone 3-hydroxylase) (Naringenin 3-dioxygenase) (FH3) (TRANSPARENT TESTA 6 protein) Length = 358 Score = 30.4 bits (67), Expect = 1.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 16 FISRRKWKTADIQCVLNNNSTKTKLATRQ 102 F+S ++K AD Q V+N+NS++ +AT Q Sbjct: 264 FLSNGRFKNADHQAVVNSNSSRLSIATFQ 292
>GT3_ARATH (Q9LF80) Putative glycosyltransferase 3 (EC 2.4.-.-) (AtGT3)| Length = 457 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 275 FADDQVLRDYGFRHAGPLSDDVR 207 FAD+QVL+ YGF H G LS ++ Sbjct: 405 FADNQVLKLYGFGHRGLLSPKIK 427
>YZ31_AQUAE (O66421) Hypothetical protein aq_aa31| Length = 270 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 31 KWKTADIQCVLNNNSTKTKLATRQV 105 +WK A I LNNN K K+AT V Sbjct: 125 EWKKAAIYAYLNNNGNKLKIATADV 149
>RLPA_ECOLI (P10100) Rare lipoprotein A precursor| Length = 362 Score = 29.3 bits (64), Expect = 2.7 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +1 Query: 67 NNSTKTKLATRQVDDDSSQKGKKRSMMTRRFRCQRLPAAAG*SNGSGRTSSLSGP 231 +N+TK ++ V D S G + T + LPA S G+G TSS+SGP Sbjct: 159 SNNTKVRIDPIIVAQDGSLSGPGMACTTVAKQTYALPAPPDLSGGAG-TSSVSGP 212
>RLPA_ECO57 (Q8XBQ1) Rare lipoprotein A precursor| Length = 362 Score = 29.3 bits (64), Expect = 2.7 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +1 Query: 67 NNSTKTKLATRQVDDDSSQKGKKRSMMTRRFRCQRLPAAAG*SNGSGRTSSLSGP 231 +N+TK ++ V D S G + T + LPA S G+G TSS+SGP Sbjct: 159 SNNTKVRIDPIIVAQDGSLSGPGMACTTVAKQTYALPAPPDLSGGAG-TSSVSGP 212
>E75BC_DROME (P17671) Ecdysone-induced protein 75B isoforms C/D (E75-A)| Length = 1199 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 39 NGGHPVCTEQQQHEDKTRH 95 NGGH +C +QQQH H Sbjct: 742 NGGHAMCQQQQQHPQLHHH 760
>E75BB_DROME (P13055) Ecdysone-induced protein 75B isoform B (E75-C)| Length = 1412 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 39 NGGHPVCTEQQQHEDKTRH 95 NGGH +C +QQQH H Sbjct: 955 NGGHAMCQQQQQHPQLHHH 973
>E75BA_DROME (P17672) Ecdysone-induced protein 75B isoform A (E75-B)| Length = 1355 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 39 NGGHPVCTEQQQHEDKTRH 95 NGGH +C +QQQH H Sbjct: 898 NGGHAMCQQQQQHPQLHHH 916
>IF2_RHIME (Q92SW4) Translation initiation factor IF-2| Length = 889 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 79 KTKLATRQVDDDSSQKGKKRSMMTRR 156 K L T VD+D SQ+G+ S M RR Sbjct: 263 KLTLTTAAVDEDGSQRGRSLSAMRRR 288
>VIT_ANTGR (Q05808) Vitellogenin precursor [Contains: YP47; YP160]| Length = 1790 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 67 NNSTKTKLATRQVDDDSSQKGKKRSMMTRRFR 162 NN +KL ++D SS++ ++ M RRFR Sbjct: 331 NNQVHSKLNENLMEDSSSEESSEQEMTHRRFR 362
>FAD6C_SOYBN (P48628) Omega-6 fatty acid desaturase, chloroplast precursor (EC| 1.14.19.-) Length = 424 Score = 28.1 bits (61), Expect = 6.1 Identities = 16/29 (55%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = -3 Query: 263 QVLRDYGFRHAG-PLSDDV------RPLP 198 Q+ DYGFR G PLSDDV PLP Sbjct: 81 QLAEDYGFRQVGEPLSDDVTLKDVINPLP 109
>DBP10_YEAST (Q12389) ATP-dependent RNA helicase DBP10 (EC 3.6.1.-) (DEAD box| protein 10) Length = 995 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +1 Query: 49 IQCVLNNNSTKTKLATRQVDDDSSQKGKKRSMMTRRFRCQRLPAA 183 +Q + N+N+ A DD++ ++ K+R+ +FR Q++PAA Sbjct: 386 LQKLQNSNNE----ADSDSDDENDRQKKRRNFKKEKFRKQKMPAA 426
>EDD1_HUMAN (O95071) Ubiquitin-protein ligase EDD1 (EC 6.3.2.-) (Hyperplastic| discs protein homolog) (hHYD) (Progestin-induced protein) Length = 2799 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +3 Query: 60 TEQQQHEDKTRHPSGRR*LFSKRKKKVDDDSPVPLSAPPGRRG 188 +E+ Q E++ RH S R + D D PL PG+RG Sbjct: 2470 SEKVQQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRG 2512
>EG13_ECHGR (Q07839) Antigen EG13| Length = 416 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +3 Query: 39 NGGHPVCTEQQQHEDKTRHPSGRR*LFSKRKKKVDDDSPVPLSAPPGRRGV 191 + G + T D T +G SK K++V+D P P GR GV Sbjct: 314 DSGSNISTSPVHTTDYTSSVNGAAAAVSKEKQRVEDTPPYPDFVDDGRPGV 364
>SM50_STRPU (P11994) 50 kDa spicule matrix protein precursor| Length = 445 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 159 PLSAPPGRRGVIERQRPHV 215 P+S PPGR V++RQ P V Sbjct: 146 PMSGPPGRAPVMKRQNPPV 164
>SM41_HEMPU (Q26264) 41 kDa spicule matrix protein precursor (HSM41) (HPSMC)| Length = 407 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 159 PLSAPPGRRGVIERQRPHV 215 P+S PPGR V++RQ P V Sbjct: 146 PMSGPPGRAPVMKRQNPPV 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,350,546 Number of Sequences: 219361 Number of extensions: 670347 Number of successful extensions: 2176 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2174 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
