ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast72g06 |
|---|---|
| Clone Library Name | barley_pub |
>SAHH2_ARATH (Q9LK36) Adenosylhomocysteinase 2 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 1) (SAH hydrolase 2) (AdoHcyase 2) Length = 485 Score = 61.6 bits (148), Expect = 4e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGARLTKLTK QS+Y+SIPVEGPYKP YRY Sbjct: 453 GKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY 485
>SAHH_CATRO (P35007) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGA+LTKLTK Q++YIS+P+EGPYKP+ YRY Sbjct: 453 GKLGAKLTKLTKDQADYISVPIEGPYKPAHYRY 485
>SAHH1_ARATH (O23255) Adenosylhomocysteinase 1 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 1) (SAH hydrolase 1) (AdoHcyase 1) (HOMOLOGY-DEPENDENT GENE SILENCING 1 protein) Length = 485 Score = 60.1 bits (144), Expect = 1e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGARLTKL+K QS+Y+SIP+EGPYKP YRY Sbjct: 453 GKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY 485
>SAHH_WHEAT (P32112) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 59.7 bits (143), Expect = 2e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGARLTKLTK+QS+YISIP+EGPYK YRY Sbjct: 453 GKLGARLTKLTKSQSDYISIPIEGPYKLRLYRY 485
>SAHH_PHASS (P50249) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 59.3 bits (142), Expect = 2e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGA+LTKLT +Q++YIS+PVEGPYKP+ YRY Sbjct: 453 GKLGAKLTKLTPSQADYISVPVEGPYKPAHYRY 485
>SAHH_TOBAC (P68173) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Cytokinin-binding protein CBP57) Length = 485 Score = 58.9 bits (141), Expect = 3e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGA+LTKL+K Q++YIS+PVEGPYKP+ YRY Sbjct: 453 GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485
>SAHH_PETCR (Q01781) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 58.9 bits (141), Expect = 3e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGA+LTKL+K Q++YIS+PVEGPYKP+ YRY Sbjct: 453 GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485
>SAHH_NICSY (P68172) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Cytokinin-binding protein CBP57) Length = 485 Score = 58.9 bits (141), Expect = 3e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGA+LTKL+K Q++YIS+PVEGPYKP+ YRY Sbjct: 453 GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485
>SAHH_MESCR (P93253) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 58.9 bits (141), Expect = 3e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLGA+LTKL+K Q++YIS+PVEGPYKP+ YRY Sbjct: 453 GKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485
>SAHH_MEDSA (P50246) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 57.4 bits (137), Expect = 8e-09 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 G+LGA+LTKL+K Q++YIS+PVEGPYKP+ YRY Sbjct: 453 GQLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485
>SAHH_PROMM (Q7V926) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+GARLT+LTK Q++YIS+PVEGPYKP YRY Sbjct: 445 KIGARLTELTKQQADYISVPVEGPYKPDHYRY 476
>SAHH_LYCES (Q9SWF5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 56.6 bits (135), Expect = 1e-08 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GK GA+LTKLTK Q++YI +PVEGPYKP+ YRY Sbjct: 453 GKFGAKLTKLTKDQADYIYVPVEGPYKPAHYRY 485
>SAHH_LUPLU (Q9SP37) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 55.5 bits (132), Expect = 3e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLGA+LTKL+K Q++YIS+PVEGPYKP YRY Sbjct: 454 KLGAKLTKLSKDQADYISVPVEGPYKPFHYRY 485
>SAHH_CHLTE (Q8KEG8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 471 Score = 54.3 bits (129), Expect = 7e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 G++GA+LT LTK Q++YI +PVEGPYKP YRY Sbjct: 439 GQIGAKLTTLTKEQADYIGVPVEGPYKPEHYRY 471
>SAHH_PROMP (Q7UZN3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 53.1 bits (126), Expect = 2e-07 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+GA+LTKLTK Q++YI++ VEGPYKP YRY Sbjct: 441 KIGAKLTKLTKDQADYINVSVEGPYKPEQYRY 472
>SAHH_SYNPX (Q7U9Y3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 51.6 bits (122), Expect = 4e-07 Identities = 20/32 (62%), Positives = 29/32 (90%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 ++GA+LT+L+K Q++YI++PVEGPYKP YRY Sbjct: 445 RIGAKLTELSKDQADYINVPVEGPYKPDHYRY 476
>SAHH_RHOBA (Q7TTZ5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 448 Score = 51.2 bits (121), Expect = 6e-07 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +G +LTKLT+ Q++YI +PVEGPYKP+ YRY Sbjct: 418 IGVKLTKLTQEQADYIGVPVEGPYKPNHYRY 448
>SAHH_ANOGA (O76757) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 432 Score = 50.8 bits (120), Expect = 7e-07 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLG +LTKL+ Q EY+++PVEGPYKP YRY Sbjct: 401 KLGVKLTKLSARQPEYLNLPVEGPYKPEHYRY 432
>SAHH_YEAST (P39954) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 449 Score = 50.4 bits (119), Expect = 1e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 G LG RLTKL+K QSEY+ IP EGP+K YRY Sbjct: 417 GNLGVRLTKLSKVQSEYLGIPEEGPFKADHYRY 449
>SAHH_TRIVA (P51540) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 486 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 G L LTKLT+ Q++YI++PVEGPYK AYRY Sbjct: 454 GSLDVHLTKLTQKQADYINVPVEGPYKSDAYRY 486
>SAHH_SCHPO (O13639) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 433 Score = 50.1 bits (118), Expect = 1e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLG +LT LT QS+Y+ IPV+GPYK YRY Sbjct: 401 GKLGVKLTTLTSVQSDYLGIPVDGPYKADHYRY 433
>SAHH_NOCFA (Q5YQS7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 49.7 bits (117), Expect = 2e-06 Identities = 22/31 (70%), Positives = 24/31 (77%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG LTKLTK Q+EYI + VEGPYKP YRY Sbjct: 464 LGGTLTKLTKDQAEYIGVDVEGPYKPEHYRY 494
>SAHH_MYCTU (P60176) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG LTKLTK Q+EY+ + VEGPYKP YRY Sbjct: 464 LGGHLTKLTKEQAEYLGVDVEGPYKPDHYRY 494
>SAHH_MYCBO (Q7TWW7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG LTKLTK Q+EY+ + VEGPYKP YRY Sbjct: 464 LGGHLTKLTKEQAEYLGVDVEGPYKPDHYRY 494
>SAHH_BORPA (Q7W1Z7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLGA+L+ L+K Q++YI +PVEGP+KP YRY Sbjct: 441 KLGAKLSTLSKQQADYIGVPVEGPFKPGHYRY 472
>SAHH_BORBR (Q7WQX5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/32 (62%), Positives = 27/32 (84%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLGA+L+ L+K Q++YI +PVEGP+KP YRY Sbjct: 441 KLGAKLSTLSKQQADYIGVPVEGPFKPGHYRY 472
>SAHH_PROMA (Q7V9P3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 49.3 bits (116), Expect = 2e-06 Identities = 19/32 (59%), Positives = 27/32 (84%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+GA LT+L+K Q++YI++P+EGPYK YRY Sbjct: 445 KIGANLTELSKEQADYINVPIEGPYKSEQYRY 476
>SAHH_DICDI (P10819) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 430 Score = 48.5 bits (114), Expect = 4e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +LGA+LT LT+ QSEY+S+PV GPYK YRY Sbjct: 399 QLGAKLTTLTEKQSEYLSVPVAGPYKVDHYRY 430
>SAHH_RAT (P10760) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 431 Score = 48.1 bits (113), Expect = 5e-06 Identities = 18/33 (54%), Positives = 26/33 (78%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKL +LTKLT+ Q++Y+ +P+ GP+KP YRY Sbjct: 399 GKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 431
>SAHH_MOUSE (P50247) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver copper-binding protein) (CUBP) Length = 431 Score = 48.1 bits (113), Expect = 5e-06 Identities = 18/33 (54%), Positives = 26/33 (78%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKL +LTKLT+ Q++Y+ +P+ GP+KP YRY Sbjct: 399 GKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 431
>SAHH_METCA (Q60CG8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 48.1 bits (113), Expect = 5e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+GARLT+L+ Q+ YI +P EGPYKP YRY Sbjct: 441 KIGARLTELSDEQAAYIGVPKEGPYKPDHYRY 472
>SAHH_BORPE (Q7VUL8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 48.1 bits (113), Expect = 5e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLG +L+ L+K Q++YI +PVEGP+KP YRY Sbjct: 441 KLGVKLSTLSKQQADYIGVPVEGPFKPDHYRY 472
>SAHH_LEIDO (P36889) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 437 Score = 47.8 bits (112), Expect = 6e-06 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +GA+LTKLT Q+EYI+ PV GP+KP YRY Sbjct: 407 VGAKLTKLTPKQAEYINCPVNGPFKPDHYRY 437
>SAHH_CHRVO (Q7NZF7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 47.4 bits (111), Expect = 8e-06 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 ++GARLT+L+ Q+ YIS+P +GPYKP YRY Sbjct: 435 RIGARLTELSDQQAAYISVPKQGPYKPDHYRY 466
>SAHH_MYCLE (Q9CCJ4) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 492 Score = 47.0 bits (110), Expect = 1e-05 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +LTKLTK Q+EY+ + V+GP+KP YRY Sbjct: 462 LGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY 492
>SAHH_LEPIN (Q8EXV1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 436 Score = 46.6 bits (109), Expect = 1e-05 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +LG RLTKL + Q++Y+ +P+ GP+KP YRY Sbjct: 405 QLGVRLTKLNQKQADYLGVPINGPFKPDHYRY 436
>SAHH_LEPIC (Q75FU8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 436 Score = 46.6 bits (109), Expect = 1e-05 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +LG RLTKL + Q++Y+ +P+ GP+KP YRY Sbjct: 405 QLGVRLTKLNQKQADYLGVPINGPFKPDHYRY 436
>SAHH_PSESM (Q87V73) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 46.6 bits (109), Expect = 1e-05 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -1 Query: 403 GARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 G +TKLTK Q++YI + VEGP+KP AYRY Sbjct: 440 GGVVTKLTKTQADYIGVTVEGPFKPDAYRY 469
>SAHH_MYCPA (Q73UK6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 496 Score = 46.2 bits (108), Expect = 2e-05 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG LTKLTK Q+EYI + V+GPYK YRY Sbjct: 466 LGGELTKLTKEQAEYIGVDVDGPYKADHYRY 496
>SAHH_CAEEL (P27604) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Protein dumpy-14) Length = 437 Score = 45.8 bits (107), Expect = 2e-05 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +LG +LTKL+ Q+ Y+ +PV GPYKP YRY Sbjct: 406 QLGVKLTKLSDEQASYLGVPVAGPYKPDHYRY 437
>SAHH_COREF (Q8FRJ4) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 478 Score = 45.8 bits (107), Expect = 2e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +LT+LTK Q+EYI + V GP+KP YRY Sbjct: 448 LGGKLTELTKEQAEYIGVDVAGPFKPEHYRY 478
>SAHH_CORDI (P61456) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 478 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +T+LTK Q+EYI + V GPYKP YRY Sbjct: 448 LGGTITELTKEQAEYIGVDVAGPYKPEHYRY 478
>SAHH_CORGL (Q8NSC4) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 474 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +LT+LTK Q+EYI + V GP+KP YRY Sbjct: 444 LGGQLTELTKEQAEYIGVDVAGPFKPEHYRY 474
>SAHH_CAUCR (Q9ABH0) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 463 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLGA+LT L K Q++YI +P GP+KP YRY Sbjct: 432 KLGAKLTTLRKDQADYIGVPEAGPFKPDHYRY 463
>SAHH_XANCP (Q8PCH5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 45.4 bits (106), Expect = 3e-05 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LT LTK Q++Y+ + V GPYKP YRY Sbjct: 449 KIGVKLTTLTKDQADYLGVDVAGPYKPDHYRY 480
>SAHH_XANAC (Q8PP84) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 45.4 bits (106), Expect = 3e-05 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LT LTK Q++Y+ + V GPYKP YRY Sbjct: 449 KIGVKLTTLTKDQADYLGVDVAGPYKPDHYRY 480
>SAHH_NITEU (Q82WL1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 478 Score = 45.1 bits (105), Expect = 4e-05 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKLG +LT+LT Q+ Y+++ GPYKP YRY Sbjct: 446 GKLGVKLTELTDEQAHYLNLDKNGPYKPEMYRY 478
>SAHH_PIG (Q710C4) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 431 Score = 44.7 bits (104), Expect = 5e-05 Identities = 18/33 (54%), Positives = 25/33 (75%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKL +LTKLT+ Q++Y+ + EGP+KP YRY Sbjct: 399 GKLNVKLTKLTEKQAQYLGMSREGPFKPDHYRY 431
>SAHHB_XENLA (O93477) Adenosylhomocysteinase B (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase B) (AdoHcyase B) Length = 433 Score = 44.3 bits (103), Expect = 7e-05 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLG +LTKLT Q++Y+ + EGP+KP YRY Sbjct: 402 KLGVKLTKLTDKQAKYLGLDKEGPFKPDHYRY 433
>SAHHA_XENLA (P51893) Adenosylhomocysteinase A (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase A) (AdoHcyase A) Length = 433 Score = 44.3 bits (103), Expect = 7e-05 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLG +LTKLT Q++Y+ + EGP+KP YRY Sbjct: 402 KLGVKLTKLTDKQAKYLGLDKEGPFKPDHYRY 433
>SAHH_HUMAN (P23526) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 431 Score = 44.3 bits (103), Expect = 7e-05 Identities = 17/33 (51%), Positives = 25/33 (75%) Frame = -1 Query: 412 GKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 GKL +LTKLT+ Q++Y+ + +GP+KP YRY Sbjct: 399 GKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 431
>SAHH_STRFR (P26799) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Fragment) Length = 120 Score = 44.3 bits (103), Expect = 7e-05 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +LT L Q+EYI + VEGPYKP YRY Sbjct: 90 LGVKLTTLRPEQAEYIGVEVEGPYKPDHYRY 120
>SAHH_DESVH (Q72EH1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 479 Score = 43.9 bits (102), Expect = 9e-05 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +LG +LT+L+K Q++YI + EGP+KP YRY Sbjct: 448 RLGVKLTRLSKDQADYIGVSPEGPFKPDHYRY 479
>SAHH_BACTN (Q8A407) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LTKLT Q+ YI + V+GPYK YRY Sbjct: 445 KIGVKLTKLTPEQAAYIGVSVDGPYKAEHYRY 476
>SAHH_BACFR (Q64MT2) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 487 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LTKLT Q+ YI + V+GPYK YRY Sbjct: 456 KIGVKLTKLTPEQAAYIGVSVDGPYKADHYRY 487
>SAHH_XYLFT (Q87EI8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LT LT Q+ Y+ I VEGP+KP YRY Sbjct: 449 KIGVKLTTLTANQAAYLGISVEGPFKPEHYRY 480
>SAHH_XYLFA (Q9PEJ1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 480 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LT LT Q+ Y+ I VEGP+KP YRY Sbjct: 449 KIGVKLTTLTANQAAYLGISVEGPFKPEHYRY 480
>SAHH_RHILO (Q98CM3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 42.7 bits (99), Expect = 2e-04 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLGARLT+L+ Q+ YI + +GP+KP YRY Sbjct: 435 KLGARLTELSGEQAAYIGVTPQGPFKPEHYRY 466
>SAHH_ACIAD (Q6FA43) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 467 Score = 42.4 bits (98), Expect = 3e-04 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -1 Query: 403 GARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 G LT+LT Q++Y+ +PVEGP+K AY+Y Sbjct: 438 GGVLTQLTSVQADYLGVPVEGPFKSDAYKY 467
>SAHH_RHOPA (Q6N2N5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LT+L K Q++YI + VEGP+K YRY Sbjct: 438 KIGVKLTELRKDQADYIGVKVEGPFKADHYRY 469
>SAHH_DROME (Q27580) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 432 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLG +LTKLT+ Q+ Y+ + GP+KP YRY Sbjct: 401 KLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 432
>SAHH_PSEAE (Q9I685) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 42.0 bits (97), Expect = 3e-04 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = -1 Query: 403 GARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 G +T+LT Q+EYI + VEGP+KP YRY Sbjct: 440 GGVVTQLTPKQAEYIGVSVEGPFKPDTYRY 469
>SAHH_GEOSL (P61617) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 475 Score = 41.6 bits (96), Expect = 5e-04 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LGA LT+LT Q+ YI +P GPYK + YRY Sbjct: 445 LGAMLTELTDEQAAYIGVPKNGPYKSAHYRY 475
>SAHH_BRAJA (Q89HP6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 473 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LT+L K Q++YI + EGPYK YRY Sbjct: 442 KIGVKLTELRKDQADYIGVKQEGPYKSDHYRY 473
>SAHH_PNECA (Q12663) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Fragment) Length = 440 Score = 41.2 bits (95), Expect = 6e-04 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLG +LT LT QS Y+ IP++GPYK YRY Sbjct: 410 KLG-KLTSLTPEQSAYLDIPIDGPYKSEHYRY 440
>SAHH_BDEBA (Q6MNC0) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 460 Score = 41.2 bits (95), Expect = 6e-04 Identities = 16/32 (50%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLG +LTKL+ Q++Y+ + +GP+KP YRY Sbjct: 429 KLGVKLTKLSSKQAKYLHMSPQGPFKPEHYRY 460
>SAHH_STRAZ (Q8GGL7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +LT L Q+ YI + V+GPYKP YRY Sbjct: 439 LGVKLTTLRPEQASYIGVEVDGPYKPDHYRY 469
>SAHH_RHOCA (P28183) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 463 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LT L Q+EYI + VEGP+K YRY Sbjct: 432 KIGVKLTTLRPDQAEYIGVTVEGPFKSDHYRY 463
>SAHH_RHIME (Q92TC1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLGA+LT+L++ Q+ YI + +GP+K YRY Sbjct: 435 KLGAKLTELSEEQASYIGVKQQGPFKAEHYRY 466
>SAHH_AGRT5 (Q8UJ99) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLG RLT+L+ Q++YI I +GP+K YRY Sbjct: 435 KLGVRLTELSDLQADYIGISKQGPFKAEHYRY 466
>SAHH_STRCO (Q9KZM1) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +LT L Q++YI + VEGPYK YRY Sbjct: 455 LGVKLTTLRPEQADYIGVKVEGPYKADHYRY 485
>SAHH_BARHE (Q6G584) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 465 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +LG +LT L++ Q+ YI + +GPYKP YRY Sbjct: 434 QLGIKLTTLSQEQAAYIGVTPQGPYKPDHYRY 465
>SAHH_RALSO (Q8Y387) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 474 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KL A+LT LT Q+ YI + EGPYK YRY Sbjct: 443 KLNAQLTVLTDKQAAYIGVSKEGPYKADHYRY 474
>SAHH_COXBU (Q83A77) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 429 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 ++G +LT LT+ Q++YI + EGP+K YRY Sbjct: 398 RVGGKLTTLTEKQADYIGVDPEGPFKSEHYRY 429
>SAHH_BARQU (Q6G1D6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 465 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/32 (46%), Positives = 24/32 (75%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 +LG +L+ L++ Q+ YI + +GPYKP+ YRY Sbjct: 434 RLGVKLSVLSEEQAVYIGVTPQGPYKPNHYRY 465
>SAHH_BRUSU (Q8FXZ7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 38.5 bits (88), Expect = 0.004 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLGA+LT L++ Q+ YI + +GP+K YRY Sbjct: 435 KLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 466
>SAHH_BRUME (Q8YE49) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 466 Score = 38.5 bits (88), Expect = 0.004 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KLGA+LT L++ Q+ YI + +GP+K YRY Sbjct: 435 KLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 466
>SAHH_RHOSH (O50562) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 463 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 K+G +LT + Q++YI + VEGP+K YRY Sbjct: 432 KIGVKLTDVRPEQADYIGVKVEGPFKAEHYRY 463
>SAHH_ROSDE (Q9ZNA5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 462 Score = 38.1 bits (87), Expect = 0.005 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 ++G +LT L Q+ YI + EGP+KP YRY Sbjct: 431 RIGVKLTPLDPEQAAYIGVKPEGPFKPEHYRY 462
>SAHH_STRAA (Q936D6) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 482 Score = 38.1 bits (87), Expect = 0.005 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +LT L Q+ YI + V+GPYK YRY Sbjct: 452 LGVKLTTLRPEQASYIGVDVDGPYKSDHYRY 482
>SAHH_STRAW (Q82DC9) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 37.4 bits (85), Expect = 0.009 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -1 Query: 406 LGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 LG +LT L Q+ YI + VEGP+K YRY Sbjct: 455 LGVKLTTLRPEQAAYIGVEVEGPFKSDHYRY 485
>SAHH_BURPS (Q63PT2) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 473 Score = 36.6 bits (83), Expect = 0.015 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 ++GA+L++L+ Q+ YI + GP+KP YRY Sbjct: 442 RIGAQLSELSDDQAAYIGVSKAGPFKPDHYRY 473
>SAHH_BURMA (Q62G22) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 473 Score = 36.6 bits (83), Expect = 0.015 Identities = 14/32 (43%), Positives = 23/32 (71%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 ++GA+L++L+ Q+ YI + GP+KP YRY Sbjct: 442 RIGAQLSELSDDQAAYIGVSKAGPFKPDHYRY 473
>SAHH3_MOUSE (Q68FL4) Putative adenosylhomocysteinase 3 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 3) (AdoHcyase 3) Length = 613 Score = 35.8 bits (81), Expect = 0.025 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 400 ARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 A LT+LT Q++Y+ + GP+KP+ YRY Sbjct: 585 AHLTELTDEQAKYLGLNKNGPFKPNYYRY 613
>SAHH3_PONPY (Q5R889) Putative adenosylhomocysteinase 3 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 3) (AdoHcyase 3) Length = 508 Score = 35.8 bits (81), Expect = 0.025 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 400 ARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 A LT+LT Q++Y+ + GP+KP+ YRY Sbjct: 480 AHLTELTDEQAKYLGLNKNGPFKPNYYRY 508
>SAHH3_HUMAN (Q96HN2) Putative adenosylhomocysteinase 3 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 3) (AdoHcyase 3) Length = 611 Score = 35.8 bits (81), Expect = 0.025 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 400 ARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 A LT+LT Q++Y+ + GP+KP+ YRY Sbjct: 583 AHLTELTDEQAKYLGLNKNGPFKPNYYRY 611
>SAHH2_MOUSE (Q80SW1) Putative adenosylhomocysteinase 2 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 2) (AdoHcyase 2) (S-adenosylhomocysteine hydrolase-like 1) (IP3R-binding protein released with inositol 1,4,5-trisphosphate) Length = 530 Score = 35.4 bits (80), Expect = 0.032 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 400 ARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 A LT+LT Q++Y+ + GP+KP+ YRY Sbjct: 502 AHLTELTDDQAKYLGLNKNGPFKPNYYRY 530
>SAHH2_HUMAN (O43865) Putative adenosylhomocysteinase 2 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 2) (AdoHcyase 2) (S-adenosylhomocysteine hydrolase-like 1) (DC-expressed AHCY-like molecule) Length = 530 Score = 35.4 bits (80), Expect = 0.032 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 400 ARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 A LT+LT Q++Y+ + GP+KP+ YRY Sbjct: 502 AHLTELTDDQAKYLGLNKNGPFKPNYYRY 530
>SAHH_PLACH (Q4XZZ5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 479 Score = 35.0 bits (79), Expect = 0.042 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KL A LT+L Q E++ + GP+K AYRY Sbjct: 448 KLNATLTELDDNQCEFLGVSKNGPFKSEAYRY 479
>SAHH_PLAYO (Q7RKK8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 479 Score = 34.7 bits (78), Expect = 0.055 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KL A LT+L Q E++ + GP+K AYRY Sbjct: 448 KLNATLTELDDNQCEFLGVSKTGPFKSEAYRY 479
>SAHH_PLAF7 (P50250) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (PfSAHH) Length = 479 Score = 32.0 bits (71), Expect = 0.36 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 409 KLGARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 KL A LT+L Q +++ + GP+K + YRY Sbjct: 448 KLNASLTELDDNQCQFLGVNKSGPFKSNEYRY 479
>OTX_STRPU (Q26417) Homeobox protein OTX (SPOTX)| Length = 371 Score = 31.6 bits (70), Expect = 0.47 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 48 QNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPP 176 Q +Q P N N +K+TPPP+ N + T ++ PP Sbjct: 191 QQQQNGPNSNNTTNKPRPAKKKTPPPTPRENDAPTTTSSDTPP 233
>SAHH2_DROME (P50245) Putative adenosylhomocysteinase 2 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 2) (AdoHcyase 2) Length = 492 Score = 31.6 bits (70), Expect = 0.47 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -1 Query: 400 ARLTKLTKAQSEYISIPVEGPYKPSAYRY 314 A LT+LT QS+++ + GP+K + YRY Sbjct: 464 AHLTELTDEQSKFMGLNKAGPFKANYYRY 492
>CMTA2_MOUSE (Q80Y50) Calmodulin-binding transcription activator 2| Length = 1208 Score = 31.2 bits (69), Expect = 0.61 Identities = 26/96 (27%), Positives = 39/96 (40%) Frame = +3 Query: 9 IDGGSIRHVKSTGQNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKRQH 188 + GS+ H S+ ++R I+P++ A+ S PP PPP Sbjct: 238 LGSGSLTHKCSSTKHRIISPKVEPRALALASISHSKPP--------------EPPP---- 279 Query: 189 A*I*IDNAKENRIVHTSPRQSSRRCACSGSAQPLVV 296 + E HTSP SS + SG A+PL + Sbjct: 280 --LIAPLPPELPKAHTSPSSSSSSSSSSGFAEPLEI 313
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 31.2 bits (69), Expect = 0.61 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +3 Query: 45 GQNRQITPRLNQNNNAIISGQ---KQTPPPSTNPNRSKNVTMTNPPP 176 G +Q + Q +N+ S +QTPPP+ PN+ N T PPP Sbjct: 570 GPPQQQQSQQQQASNSASSASNSPQQTPPPAPPPNQGMNNMATPPPP 616
>CCDC6_HUMAN (Q16204) Coiled-coil domain-containing protein 6 (H4 protein)| (Papillary thyroid carcinoma-encoded protein) Length = 585 Score = 29.3 bits (64), Expect = 2.3 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +3 Query: 30 HVKSTGQNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKRQ 185 HV+ G + IT + +N+ ++ TPPPS N PPP Q Sbjct: 399 HVQHMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQ 450
>P2RY2_HUMAN (P41231) P2Y purinoceptor 2 (P2Y2) (P2U purinoceptor 1) (P2U1) (ATP| receptor) (Purinergic receptor) Length = 377 Score = 28.9 bits (63), Expect = 3.0 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 324 PTGTSASTPARLAAGLSLSRRTD 256 PTG S +TPAR GL S RTD Sbjct: 323 PTGPSPATPARRRLGLRRSDRTD 345
>AEX3_CAEEL (O02626) Regulator of presynaptic activity aex-3 (Aboc, expulsion| defective protein 3) Length = 1409 Score = 28.9 bits (63), Expect = 3.0 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +3 Query: 36 KSTGQNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPP 176 K GQN +TP N+ S + PP P + + NPPP Sbjct: 939 KPLGQN--VTPTSTNNHEIAQSTRSPALPPPVPPREAPPIPKRNPPP 983
>PDE4A_DROME (Q9W4T4) cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 1209 Score = 28.5 bits (62), Expect = 4.0 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 6/62 (9%) Frame = +3 Query: 123 PSTNP------NRSKNVTMTNPPPKRQHA*I*IDNAKENRIVHTSPRQSSRRCACSGSAQ 284 PSTNP N+ +N +NP P N+ +T+P Q+ +RC+C Sbjct: 281 PSTNPCQSAVQNQGQN---SNPNP--------------NQNPNTNPNQNQQRCSCQPQTS 323 Query: 285 PL 290 PL Sbjct: 324 PL 325
>P60_LISMO (P21171) Protein p60 precursor (Invasion-associated protein)| Length = 484 Score = 28.5 bits (62), Expect = 4.0 Identities = 27/103 (26%), Positives = 36/103 (34%), Gaps = 11/103 (10%) Frame = +3 Query: 36 KSTGQNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSK-----------NVTMTNPPPKR 182 K T +Q P+ A K P PSTN N +K N T TN P K Sbjct: 286 KETATQQQTAPK------APTEAAKPAPAPSTNTNANKTNTNTNTNTNTNNTNTNTPSKN 339 Query: 183 QHA*I*IDNAKENRIVHTSPRQSSRRCACSGSAQPLVVLEWTH 311 + N N +T+ Q S + SA ++ H Sbjct: 340 TNT---NSNTNTNTNSNTNANQGSSNNNSNSSASAIIAEAQKH 379
>ABIL2_ARATH (Q9M3A3) Protein ABIL2 (Abl interactor-like protein 2) (AtABIL2)| Length = 312 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = +3 Query: 21 SIRHVKSTGQNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPK 179 ++ +K G + + NQ NA+ + ++TPPP + S++ + PP + Sbjct: 146 NLEKLKYFGSSLEDADDWNQFRNAVRATIRETPPPPVRKSTSQSSSPRQPPQR 198
>TOP2A_HUMAN (P11388) DNA topoisomerase 2-alpha (EC 5.99.1.3) (DNA topoisomerase| II, alpha isozyme) Length = 1531 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 39 STGQNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTN 167 +TG ++ P+ + + A+ SG Q P P+ NR K T+ Sbjct: 1429 TTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTS 1471
>Y361_HAEIN (P44662) Probable iron transport system ATP-binding protein HI0361| Length = 306 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 8/50 (16%) Frame = +3 Query: 15 GGSIRHVKSTGQN-------RQITPRLNQNNNAIISGQ-KQTPPPSTNPN 140 GG +RH+K G+N R +T + + G+ KQ PP T N Sbjct: 240 GGVLRHIKLLGENLHNDEDKRSVTVLTDDEKAVVFYGETKQDPPAPTTQN 289
>KLK6_MOUSE (P15947) Glandular kallikrein K6 precursor (EC 3.4.21.35) (Tissue| kallikrein-6) (mGK-6) (Renal kallikrein) (KAL-B) Length = 261 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 260 VRLLRLSPAASRAGVDALVPVGRRLVGTLNWDAN 361 +R L L A S G+DA PV R+VG N + N Sbjct: 1 MRFLILFLALSLGGIDAAPPVQSRIVGGFNCEKN 34
>CNTN2_CHICK (P28685) Contactin-2 precursor (Axonin-1)| Length = 1036 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 72 LNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKR 182 LN N +S + + P+ S N+T T PPP+R Sbjct: 874 LNPNTKYHVSVRAYNRAGAGPPSPSTNITTTKPPPRR 910
>DLG7_HUMAN (Q15398) Discs large homolog 7 (Hepatoma up-regulated protein)| (HURP) Length = 846 Score = 27.3 bits (59), Expect = 8.8 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = +3 Query: 72 LNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKRQHA*I*IDNAKENRIVHTSPRQS 251 L N NA+ + K+ P S RSK K Q IDN + R + PRQ+ Sbjct: 131 LLSNQNAVKAEPKKAIPSSVRITRSK--------AKDQMEQTKIDNESDVRAIRPGPRQT 182 Query: 252 SRR 260 S + Sbjct: 183 SEK 185
>PMPC_CHLMU (Q9PJY1) Probable outer membrane protein pmpC precursor (Polymorphic| membrane protein C) Length = 1460 Score = 27.3 bits (59), Expect = 8.8 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 10/68 (14%) Frame = +3 Query: 3 IAIDGGSIRHVKSTGQNRQITPRLNQNNNAIISGQKQTPPPSTN--PNR--------SKN 152 + ID S+ ++G N + P L + + SG + PPS+N PN SKN Sbjct: 967 LTIDLSSVGRNSASGDNIFMPPELRIVDTSTNSGNSSSTPPSSNTPPNSTPTAQAPISKN 1026 Query: 153 VTMTNPPP 176 T P Sbjct: 1027 FAATTTTP 1034
>CENG3_HUMAN (Q96P47) Centaurin-gamma 3 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 3) (AGAP-3) (MR1-interacting protein) (MRIP-1) (CRAM-associated GTPase) (CRAG) Length = 875 Score = 27.3 bits (59), Expect = 8.8 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = -2 Query: 360 LASQLRVPTSRLPTGTSASTP--ARLAAGLSLSRRTD--GNSASATYELSCFPLH 208 L + ++VP RLP T A+ P + A GLS+ R G A + S LH Sbjct: 420 LRTTVKVPGKRLPRATPATAPGTSPRANGLSVERSNTQLGGGTGAPHSASSASLH 474
>WBP11_HUMAN (Q9Y2W2) WW domain-binding protein 11 (WBP-11) (SH3 domain-binding| protein SNP70) (Npw38-binding protein) (NpwBP) Length = 641 Score = 27.3 bits (59), Expect = 8.8 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 75 NQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPP 176 + + + S Q+Q PP S P++ + M PPP Sbjct: 379 HSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPP 412
>VLDLR_RABIT (P35953) Very low-density lipoprotein receptor precursor (VLDL| receptor) (VLDL-R) Length = 873 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 4/25 (16%) Frame = +1 Query: 295 CW----SGRTSTGRQTACRDPQLGC 357 CW SG T+TGR+T C Q C Sbjct: 16 CWALRESGATATGRKTKCEASQFQC 40
>NCOR2_HUMAN (Q9Y618) Nuclear receptor corepressor 2 (N-CoR2) (Silencing mediator| of retinoic acid and thyroid hormone receptor) (SMRT) (SMRTe) (Thyroid-, retinoic-acid-receptor-associated corepressor) (T3 receptor-associating factor) (TRAC) (CTG repeat p Length = 2517 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/66 (22%), Positives = 32/66 (48%) Frame = +3 Query: 60 ITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKRQHA*I*IDNAKENRIVHTS 239 I P L + + ++ + P + + R VTM P P+ Q + A ++R + ++ Sbjct: 1529 IVPELGKPRQSPLTYEDHGAPFAGHLPRGSPVTMREPTPRLQEGSLSSSKASQDRKLTST 1588 Query: 240 PRQSSR 257 PR+ ++ Sbjct: 1589 PREIAK 1594
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 27.3 bits (59), Expect = 8.8 Identities = 21/97 (21%), Positives = 46/97 (47%), Gaps = 10/97 (10%) Frame = +3 Query: 27 RHVKSTG---QNRQITPRLNQNNNAIISGQKQTPPP-------STNPNRSKNVTMTNPPP 176 RH +S + R+ + L+ ++++ S + ++PP S+ P +++ ++ + PP Sbjct: 333 RHRRSRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTVSSPPRKTRRLSPSASPP 392 Query: 177 KRQHA*I*IDNAKENRIVHTSPRQSSRRCACSGSAQP 287 +R+H + +P+QS+R GS P Sbjct: 393 RRRHRPSPPASPPPKPRRSPTPQQSNRARKSRGSVSP 429
>YJ53_YEAST (P47129) Hypothetical 35.5 kDa protein in MIR1-STE18 intergenic| region Length = 309 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 7/42 (16%) Frame = +3 Query: 72 LNQNNNAIISGQKQTPPPSTN-------PNRSKNVTMTNPPP 176 +N N N + +K PPP+ + P+RS T T+ PP Sbjct: 177 VNSNINNTLPNRKPNPPPNRSQRMQNIAPSRSSESTPTSGPP 218
>SCD5_YEAST (P34758) Protein SCD5 (Protein FTB1)| Length = 872 Score = 27.3 bits (59), Expect = 8.8 Identities = 20/74 (27%), Positives = 30/74 (40%) Frame = +3 Query: 21 SIRHVKSTGQNRQITPRLNQNNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKRQHA*I* 200 S +H S Q I+P+ NN Q Q PP P + PP+ ++ + Sbjct: 636 SPQHTYSNNQATMISPQNTYTNN---QQQPQHLPPPPPPRAQQQQQGAIVPPQHMYSNV- 691 Query: 201 IDNAKENRIVHTSP 242 K+N +V T P Sbjct: 692 ---QKQNNLVPTQP 702
>Y564_MYCLE (Q9CCN9) Hypothetical UPF0052 protein ML0564| Length = 359 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 260 VRLLRLSPAASRAGVDALVPVGRRLVGTLNWDANV 364 VRLL + P A+R VDA++ ++G +W +V Sbjct: 172 VRLLPVDPPATRQAVDAIMAANLVVLGPGSWFTSV 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,067,438 Number of Sequences: 219361 Number of extensions: 1090294 Number of successful extensions: 3338 Number of sequences better than 10.0: 115 Number of HSP's better than 10.0 without gapping: 3089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3321 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
