| Clone Name | rbast72f02 |
|---|---|
| Clone Library Name | barley_pub |
>RS6_ASPOF (Q9M3V8) 40S ribosomal protein S6| Length = 251 Score = 58.9 bits (141), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 316 SEAAEYQKLLAQRLKEQRDRRSESMAKRRSKLS 218 SEAAEYQKLLA RLKEQRDRRSES+AK+RS+LS Sbjct: 208 SEAAEYQKLLASRLKEQRDRRSESLAKKRSRLS 240
>RS6B_ARATH (P51430) 40S ribosomal protein S6-2| Length = 249 Score = 56.6 bits (135), Expect = 2e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 316 SEAAEYQKLLAQRLKEQRDRRSESMAKRRSKLS 218 S+AA+YQKLLA RLKEQRDRRSES+AK+RS+LS Sbjct: 208 SDAADYQKLLASRLKEQRDRRSESLAKKRSRLS 240
>RS6A_ARATH (O48549) 40S ribosomal protein S6-1| Length = 250 Score = 56.6 bits (135), Expect = 2e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 316 SEAAEYQKLLAQRLKEQRDRRSESMAKRRSKLS 218 S+AA+YQKLLA RLKEQRDRRSES+AK+RS+LS Sbjct: 208 SDAADYQKLLASRLKEQRDRRSESLAKKRSRLS 240
>RS6_TOBAC (P29345) 40S ribosomal protein S6 (Fragment)| Length = 199 Score = 56.2 bits (134), Expect = 2e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 316 SEAAEYQKLLAQRLKEQRDRRSESMAKRRSKLS 218 SEAAEYQKLLA RLKEQR++RSES+AK+RS+LS Sbjct: 158 SEAAEYQKLLASRLKEQREKRSESLAKKRSRLS 190
>RS6_ICTPU (Q90YR8) 40S ribosomal protein S6| Length = 249 Score = 41.6 bits (96), Expect = 5e-04 Identities = 19/28 (67%), Positives = 24/28 (85%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRR 230 EAAEY KLLA+RLKE +++R E +AKRR Sbjct: 205 EAAEYAKLLAKRLKEAKEKRQEKIAKRR 232
>RS6_RAT (P62755) 40S ribosomal protein S6| Length = 249 Score = 40.8 bits (94), Expect = 9e-04 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRR 230 EAAEY KLLA+R+KE +++R E +AKRR Sbjct: 205 EAAEYAKLLAKRMKEAKEKRQEQIAKRR 232
>RS6_MOUSE (P62754) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 40.8 bits (94), Expect = 9e-04 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRR 230 EAAEY KLLA+R+KE +++R E +AKRR Sbjct: 205 EAAEYAKLLAKRMKEAKEKRQEQIAKRR 232
>RS6_HUMAN (P62753) 40S ribosomal protein S6 (Phosphoprotein NP33)| Length = 249 Score = 40.8 bits (94), Expect = 9e-04 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRR 230 EAAEY KLLA+R+KE +++R E +AKRR Sbjct: 205 EAAEYAKLLAKRMKEAKEKRQEQIAKRR 232
>RS6_ONCMY (Q9YGF2) 40S ribosomal protein S6| Length = 249 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRR 230 EA+EY KLLA+R+KE +++R E +AKRR Sbjct: 205 EASEYAKLLAKRMKEAKEKRQEQIAKRR 232
>RS6_CHICK (P47838) 40S ribosomal protein S6| Length = 249 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRR 230 EAA+Y KLLA+R+KE +++R E +AKRR Sbjct: 205 EAADYAKLLAKRMKEAKEKRQEQIAKRR 232
>RS6_XENLA (P39017) 40S ribosomal protein S6| Length = 249 Score = 38.1 bits (87), Expect = 0.006 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRR 230 EA+EY KLLA+R KE +++R E +AKRR Sbjct: 205 EASEYAKLLAKRSKEAKEKRQEQIAKRR 232
>RS6_MANSE (Q94624) 40S ribosomal protein S6| Length = 253 Score = 35.0 bits (79), Expect = 0.048 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -1 Query: 316 SEAAEYQKLLAQRLKEQRDRRSESMAKRRS 227 S A+Y KLLAQR KE + RR E + +RRS Sbjct: 208 SAEADYAKLLAQRKKESKVRRQEEIKRRRS 237
>RS6_SPOFR (Q95V32) 40S ribosomal protein S6| Length = 253 Score = 33.1 bits (74), Expect = 0.18 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -1 Query: 304 EYQKLLAQRLKEQRDRRSESMAKRRS 227 +Y KLLAQR KE + RR E + +RRS Sbjct: 212 DYAKLLAQRKKESKVRRQEELKRRRS 237
>RS6_DEBHA (Q6BXH8) 40S ribosomal protein S6| Length = 236 Score = 32.3 bits (72), Expect = 0.31 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -1 Query: 310 AAEYQKLLAQRLKEQRDRRSESMAKRRSKL 221 AAEY +LLAQRL E++ R+E +R S L Sbjct: 205 AAEYAQLLAQRLHERKAERAEIKKRRASSL 234
>RS6_APLCA (Q9BMX5) 40S ribosomal protein S6| Length = 247 Score = 31.2 bits (69), Expect = 0.69 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -1 Query: 307 AEYQKLLAQRLKEQRDRRSE-SMAKRRSK 224 AEY KLLAQR+KE ++R+ E + RSK Sbjct: 208 AEYTKLLAQRMKEAKERKMERKRSNSRSK 236
>RS6_CANGA (Q6FJH3) 40S ribosomal protein S6| Length = 236 Score = 30.8 bits (68), Expect = 0.90 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -1 Query: 310 AAEYQKLLAQRLKEQRDRRSESMAKRRSKL 221 AAEY +LLA+RL E++ ++E+ +R S L Sbjct: 205 AAEYAQLLAKRLAERKAEKAETRKRRASSL 234
>RS6_ASHGO (Q74ZK3) 40S ribosomal protein S6| Length = 236 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -1 Query: 310 AAEYQKLLAQRLKEQRDRRSESMAKRRSKL 221 AAEY +LLA+RL E++ ++E +R S L Sbjct: 205 AAEYAQLLAKRLTEKKAEKAEERKRRASSL 234
>RS6_YARLI (Q6C169) 40S ribosomal protein S6| Length = 242 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = -1 Query: 310 AAEYQKLLAQRLKEQRDRRSESMAKRRSKL 221 AAEY +LLA+R+ E++ ++E +R S L Sbjct: 206 AAEYAQLLAKRVAEKKSEKAEEKKRRASSL 235
>RS6_YEAST (P02365) 40S ribosomal protein S6 (S10) (YS4) (RP9)| Length = 236 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -1 Query: 310 AAEYQKLLAQRLKEQRDRRSESMAKRRSKL 221 AAEY +LLA+RL E++ ++E +R S L Sbjct: 205 AAEYAQLLAKRLSERKAEKAEIRKRRASSL 234
>RS6_KLULA (Q6CM04) 40S ribosomal protein S6| Length = 236 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -1 Query: 310 AAEYQKLLAQRLKEQRDRRSESMAKRRSKL 221 AAEY +LLA+RL E++ ++E +R S L Sbjct: 205 AAEYAQLLAKRLSERKAEKAEVRKRRASSL 234
>COX3_CHOCR (P48872) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide III) Length = 272 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 142 ATFSFLGLVIDAVLREHGYFIVGSFVTGVAFLCLYLMQFT 23 A+ I V+ H Y + GSF+ ++F CL L+ FT Sbjct: 28 ASLCAFSCAIGGVMYMHAY-VNGSFILSISFFCLLLVMFT 66
>RS6_DROME (P29327) 40S ribosomal protein S6| Length = 248 Score = 29.3 bits (64), Expect = 2.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 310 AAEYQKLLAQRLKEQRDRRSESMAKRRSKL 221 +A+Y KLL QR KE + +R E+ +R + + Sbjct: 207 SADYAKLLVQRKKESKAKREEAKRRRSASI 236
>RS6_BRAFL (O01727) 40S ribosomal protein S6| Length = 244 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRRS 227 E A Y KLLA+R KE+R E+ AKRRS Sbjct: 206 EEATYAKLLAKRKKEER----EAHAKRRS 230
>RS6_CAEEL (Q9NEN6) 40S ribosomal protein S6| Length = 246 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -1 Query: 313 EAAEYQKLLAQRLKEQRDRRSESMAKRRSKLS 218 +AA Y KLLA+ KE+ D + +A+RRS S Sbjct: 205 DAAAYHKLLAKYSKEEHDAK---IARRRSSAS 233 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,202,981 Number of Sequences: 219361 Number of extensions: 545812 Number of successful extensions: 1870 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1870 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)