| Clone Name | rbast72d04 |
|---|---|
| Clone Library Name | barley_pub |
>UNG_SFVKA (P32941) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 218 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 162 IHHHHAWNMNGIHQVFPFNYYCSFLFG 82 + ++ +N+N + VFP+NYY S G Sbjct: 102 VRYYKGYNLNNVEGVFPWNYYLSCKIG 128
>DIDO1_HUMAN (Q9BTC0) Death-inducer obliterator 1 (DIO-1) (Death-associated| transcription factor 1) (DATF-1) (hDido1) Length = 2240 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 247 AAAGRSMANLDSLINDVFMQPPPKPAIP 164 AA G SMA+ ++D M PPPK ++P Sbjct: 1505 AAVGVSMAHFS--VSDALMSPPPKSSLP 1530
>YPDB_SHIFL (P0AE41) Hypothetical response regulatory protein ypdB| Length = 244 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 204 TMFSCNLPPSRQFQIHHHHAWNMNGIHQVFPF 109 T F LPPS F+ H N+N I ++ P+ Sbjct: 181 TEFCSKLPPSHFFRCHRSFCVNLNKIREIEPW 212
>YPDB_ECOLI (P0AE39) Hypothetical response regulatory protein ypdB| Length = 244 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 204 TMFSCNLPPSRQFQIHHHHAWNMNGIHQVFPF 109 T F LPPS F+ H N+N I ++ P+ Sbjct: 181 TEFCSKLPPSHFFRCHRSFCVNLNKIREIEPW 212
>YPDB_ECO57 (P0AE40) Hypothetical response regulatory protein ypdB| Length = 244 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 204 TMFSCNLPPSRQFQIHHHHAWNMNGIHQVFPF 109 T F LPPS F+ H N+N I ++ P+ Sbjct: 181 TEFCSKLPPSHFFRCHRSFCVNLNKIREIEPW 212
>YPDB_ECOL6 (Q8FFE0) Hypothetical response regulatory protein ypdB| Length = 245 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 204 TMFSCNLPPSRQFQIHHHHAWNMNGIHQVFPF 109 T F LPPS F+ H N+N I ++ P+ Sbjct: 182 TEFFSKLPPSHFFRCHRSFCVNLNKIREIEPW 213 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,356,961 Number of Sequences: 219361 Number of extensions: 723426 Number of successful extensions: 2599 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2597 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)