| Clone Name | rbast72c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NBEA_DROME (Q9W4E2) Protein neurobeachin (Protein rugose) (A-kin... | 27 | 9.8 | 2 | PPAP_HUMAN (P15309) Prostatic acid phosphatase precursor (EC 3.1... | 27 | 9.8 |
|---|
>NBEA_DROME (Q9W4E2) Protein neurobeachin (Protein rugose) (A-kinase anchor| protein 550) (AKAP 550) (dAKAP550) Length = 3584 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +1 Query: 151 KNRQQKQDRSTKLEHYIVQEMLPPHAHCHLR*L*YSFMPSYYREEAHQR 297 + +QQ+Q + + +HY Q+ H H + +YY+++ HQ+ Sbjct: 2012 QQQQQQQQQHQQQQHYYQQQQQQQVVHNHSH---HHMTAAYYQQQQHQQ 2057
>PPAP_HUMAN (P15309) Prostatic acid phosphatase precursor (EC 3.1.3.2)| Length = 386 Score = 27.3 bits (59), Expect = 9.8 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 211 MLPPHAHCHLR*L*YS----FMPSYYREEAHQREH 303 +LPP+A CHL L + F+ YYR E + Sbjct: 306 LLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPY 340 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,379,314 Number of Sequences: 219361 Number of extensions: 492526 Number of successful extensions: 1120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)